KEGG   Mycobacterium tuberculosis variant bovis BCG Pasteur 1173P2: BCG_1221cHelp
Entry
BCG_1221c         CDS       T00463                                 

Definition
(GenBank) Hypothetical protein
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
mbb  Mycobacterium tuberculosis variant bovis BCG Pasteur 1173P2
Pathway
mbb00790  Folate biosynthesis
mbb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BCG_1221c
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mbb04147]
    BCG_1221c
Enzymes [BR:mbb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     BCG_1221c
Exosome [BR:mbb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCG_1221c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a IF-2
Motif
Other DBs
NCBI-ProteinID: CAL71208
UniProt: A1KHV0
Position
complement(1317628..1317912)
Genome map
AA seq 94 aa AA seqDB search
MAVLTDEQVDAALHDLNGWQRAGGVLRRSIKFPTFMAGIDAVRRVAERAEEVNHHPDIDI
RWRTVTFALVTHAVGGITENDIAMAHDIDAMFGA
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgttaacggatgagcaggtcgacgccgcactgcacgacctcaacggctggcag
cgcgccggtggtgtcctgcgtaggtcaatcaagtttccgacgtttatggccggtatcgac
gccgtacgccgggtggccgagcgagccgaggaggtaaatcatcatccggacatcgatatc
cgttggcgaacagtaactttcgcgctggttacgcatgcggtaggtggtatcacggaaaac
gacattgcgatggcgcacgatatcgacgcaatgtttggggcctaa

DBGET integrated database retrieval system