KEGG   Mycobacterium bovis BCG Pasteur 1173P2: BCG_2048cHelp
Entry
BCG_2048c         CDS       T00463                                 

Gene name
pfkB
Definition
(GenBank) Probable phosphofructokinase pfkB
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
mbb  Mycobacterium bovis BCG Pasteur 1173P2
Pathway
mbb00010  Glycolysis / Gluconeogenesis
mbb00030  Pentose phosphate pathway
mbb00051  Fructose and mannose metabolism
mbb00052  Galactose metabolism
mbb00680  Methane metabolism
mbb01100  Metabolic pathways
mbb01110  Biosynthesis of secondary metabolites
mbb01120  Microbial metabolism in diverse environments
mbb01130  Biosynthesis of antibiotics
mbb01200  Carbon metabolism
mbb01230  Biosynthesis of amino acids
Module
mbb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mbb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCG_2048c (pfkB)
   00030 Pentose phosphate pathway
    BCG_2048c (pfkB)
   00051 Fructose and mannose metabolism
    BCG_2048c (pfkB)
   00052 Galactose metabolism
    BCG_2048c (pfkB)
  Energy metabolism
   00680 Methane metabolism
    BCG_2048c (pfkB)
Enzymes [BR:mbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BCG_2048c (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: CAL72036
UniProt: A0A0H3MEH6
Position
complement(2259057..2260076)
Genome map
AA seq 339 aa AA seqDB search
MTEPAAWDEGKPRIITLTMNPALDITTSVDVVRPTEKMRCGAPRYDPGGGGINVARIVHV
LGGCSTALFPAGGSTGSLLMALLGDAGVPFRVIPIAASTRESFTVNESRTAKQYRFVLPG
PSLTVAEQEQCLDELRGAAASAAFVVASGSLPPGVAADYYQRVADICRRSSTPLILDTSG
GGLQHISSGVFLLKASVRELRECVGSELLTEPEQLAAAHELIDRGRAEVVVVSLGSQGAL
LATRHASHRFSSIPMTAVSGVGAGDAMVAAITVGLSRGWSLIKSVRLGNAAGAAMLLTPG
TAACNRDDVERFFELAAEPTEVGQDQYVWHPIVNPEASP
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgacggagccagcggcgtgggacgaaggcaagccgcgaatcatcactttgaccatgaac
cccgccttggacatcacgacgagcgtcgacgtggtgcgcccgaccgagaaaatgcgttgt
ggcgcacctcgctacgatcccggcggcggcggtatcaatgtcgcccgcattgtgcatgtc
ctcggcggttgctcgacagcactgttcccggccggcgggtcgaccgggagcctgctgatg
gcgctgctcggtgatgcgggagtgccatttcgcgtcattccgatcgcggcctcgacgcgg
gagagcttcacggtcaacgagtccaggaccgccaagcagtatcgtttcgtgcttccgggg
ccgtcgctgaccgtcgcggagcaggagcaatgcctcgacgaactgcgcggtgcggcggct
tcggccgcctttgtggtggccagtggcagcctgccgccaggtgtggctgccgactactat
cagcgggttgccgacatctgccgccgatcgagcactccgctgatcctggatacatctggt
ggcgggttgcagcacatttcgtccggggtgtttcttctcaaggcgagcgtgcgggaactg
cgcgagtgcgtcggatccgaactgctgaccgagcccgaacaactggccgccgcacacgaa
ctcattgaccgtgggcgcgccgaggtcgtggtggtctcgcttggatctcagggcgcgcta
ttggccacacgacatgcgagccatcgattttcgtcgattccgatgaccgcggttagcggt
gtcggcgccggcgacgcgatggtggccgcgattaccgtgggcctcagccgtggctggtcg
ctcatcaagtccgttcgcttgggaaacgcggcaggtgcagccatgctgctgacgccaggc
accgcggcctgcaatcgcgacgatgtggagaggttcttcgagctggcggccgaacccacc
gaagtcgggcaggatcaatacgtttggcacccgatcgttaacccggaagcctcgccatga

DBGET integrated database retrieval system