KEGG   Mycobacterium bovis BCG Pasteur 1173P2: BCG_2870cHelp
Entry
BCG_2870c         CDS       T00463                                 

Definition
(GenBank) Possible magnesium chelatase
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mbb  Mycobacterium bovis BCG Pasteur 1173P2
Pathway
mbb00860  Porphyrin and chlorophyll metabolism
mbb01100  Metabolic pathways
mbb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mbb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BCG_2870c
Enzymes [BR:mbb01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     BCG_2870c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_5 VWA_2 VWA Mg_chelatase MCM Sigma54_activat AAA_3 AAA VWA_3
Motif
Other DBs
NCBI-ProteinID: CAL72859
UniProt: A0A0H3M7M1
Position
complement(3112151..3114040)
Genome map
AA seq 629 aa AA seqDB search
MKPYPFSAIVGHDRLRLALLLCAVRPEIGGALIRGEKGTAKSTAVRGLAALLSVATGSTE
TGLVELPLGATEDRVVGSLDLQRVMRDGEHAFSPGLLARAHGGVLYVDEVNLLHDHLVDI
LLDAAAMGRVHVERDGISHSHEARFVLIGTMNPEEGELRPQLLDRFGLTVDVQASRDIDV
RVQVIRRRMAYEADPDAFVARYADADAELAHRIAAARATVDDVVLGDNELRRIAALCAAF
DVDGMRADLVVARTAAAHAAWRGVRTVEEQDIQAAAELALPHRRRRDPFDDHGIDRDQLD
EALALASVDPEPEPDPPGGGQSANEPASQPNSRSKSTEPGAPSSMGDDPPRPASPRLRSS
PRPSAPPSKIFRTRALRVPGVGTGAPGRRSRARNASGSVVAAAEVSDPDAHGLHLFATLL
AAGERAFGAGPLRPWPDDVRRAIRESREGNLVIFVVDASGSMAARDRMAAVSGATLSLLR
DAYQRRDKVAVITFRQHEATLLLSPTSSAHIAGRRLARFSTGGKTPLAEGLLAARALIIR
EKVRDRARRPLVVVLTDGRATAGPDPLGRSRTAAAGLVAEGAAAVVVDCETSYVRLGLAA
QLARQLGAPVVRLEQLHADYLVHAVRGVA
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
gtgaagccttatccgttcagcgcgatcgtcgggcacgatcggctgcggctcgcgttgttg
ttgtgtgccgtgcgaccggagatcggtggggcgctcatccgtggcgagaagggcacggcg
aaatcgacggcggtgcgcgggctggccgcgttgttgtcggtcgcgaccgggagcaccgag
accggcctcgtggagctgccgctgggggccaccgaagaccgggtggttggctcgctggat
ctgcagcgggtgatgcgcgacggcgagcacgcgttctctccgggactgctggctcgcgcc
cacggcggcgtgctctacgtcgacgaggtcaatctgctgcatgatcacctggttgacatc
ctgctcgacgccgccgccatgggacgcgtacacgtcgaacgcgacggcatctcccattcc
cacgaggcccgtttcgtgctgatcggcacgatgaatccggaggagggcgaactgcgtccg
cagctgctggaccggttcgggctgaccgtcgacgtgcaggcgtcacgtgacatcgacgtg
cgggtacaggtcatccgccggcggatggcctacgaagccgacccggatgcgttcgtcgca
cgctatgccgacgccgacgcggagctggcccaccggattgccgcggcccgggccacggta
gacgatgtggtgttgggcgacaacgagttgcggcgcatcgctgcgttgtgcgcggcgttc
gacgtggacggcatgcgggccgatctggtagtggcccggaccgccgccgcgcacgccgcc
tggcgtggtgtccgcaccgttgaggagcaggatatccaggcggcagcagaactggcgttg
ccgcatcgtcgtcgtcgcgacccgttcgacgatcacggcatcgaccgcgaccagctggat
gaggcgctggcgctggcgagcgtcgacccagagcccgagcccgatccgcccgggggcggc
cagtcagccaatgaacctgcctcacaaccgaactcacgctcgaagtcgacagaacctggt
gcgccgagctcgatgggcgacgacccgccgcgcccggcttcgccgcgcttgcgatcgtcg
ccgcgcccgagcgcgccgccgtcaaagatattccggacccgcgcgctgcgggtcccgggg
gtcggcacgggcgcgccggggcgacggtctcgggcccgcaacgcctcgggcagtgtggtg
gcggccgccgaggtcagcgaccccgacgcacatggactgcacctgttcgctaccctgctg
gccgccggcgagcgtgcgttcggagccgggccgttgcgcccgtggccggacgatgtgcgc
cgggccatccgcgagagtcgcgaaggcaatctggtgatcttcgtcgtcgacgcttccgga
tcgatggctgctcgggaccggatggctgcggtcagtggcgccaccctgtcgctgctgcgc
gacgcctaccagcgcagggacaaggtggcggtgatcaccttccgccagcacgaggcaacg
ctgttgctgtcgccgacgtcgtcggcgcacatcgccggccggcgactggcccgattcagc
accggcggcaagaccccgctggctgagggactgctggccgcgcgtgcgctgatcatccgg
gagaaggtacgcgaccgcgcccgacgccccctggtggtcgtgctgaccgacggccgggcc
accgccgggccggacccgttgggccgcagccgaaccgcggctgccgggctggtcgccgag
ggcgcggccgcggtggtggtggactgcgaaacgtcgtatgtacggctgggtttggcagcg
caactggctcgtcagctgggtgcgccggtggttcggttggagcagttgcacgcggattat
ctagtgcatgccgtgcgtggcgtggcttga

DBGET integrated database retrieval system