KEGG   Mycobacterium bovis BCG Pasteur 1173P2: BCG_3587Help
Entry
BCG_3587          CDS       T00463                                 

Definition
(GenBank) Probable lipid carrier protein or keto acyl-coa thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mbb  Mycobacterium bovis BCG Pasteur 1173P2
Pathway
mbb00071  Fatty acid degradation
mbb00072  Synthesis and degradation of ketone bodies
mbb00280  Valine, leucine and isoleucine degradation
mbb00310  Lysine degradation
mbb00362  Benzoate degradation
mbb00380  Tryptophan metabolism
mbb00620  Pyruvate metabolism
mbb00630  Glyoxylate and dicarboxylate metabolism
mbb00640  Propanoate metabolism
mbb00650  Butanoate metabolism
mbb00900  Terpenoid backbone biosynthesis
mbb01100  Metabolic pathways
mbb01110  Biosynthesis of secondary metabolites
mbb01120  Microbial metabolism in diverse environments
mbb01130  Biosynthesis of antibiotics
mbb01200  Carbon metabolism
mbb01212  Fatty acid metabolism
mbb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mbb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCG_3587
   00630 Glyoxylate and dicarboxylate metabolism
    BCG_3587
   00640 Propanoate metabolism
    BCG_3587
   00650 Butanoate metabolism
    BCG_3587
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BCG_3587
   00072 Synthesis and degradation of ketone bodies
    BCG_3587
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCG_3587
   00310 Lysine degradation
    BCG_3587
   00380 Tryptophan metabolism
    BCG_3587
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BCG_3587
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCG_3587
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BCG_3587
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mbb04147]
    BCG_3587
Enzymes [BR:mbb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BCG_3587
Exosome [BR:mbb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCG_3587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M22 Thiolase_N
Motif
Other DBs
NCBI-ProteinID: CAL73576
UniProt: A0A0H3M9S2
Position
3938421..3939605
Genome map
AA seq 394 aa AA seqDB search
MAGKLAAVLGTGQTKYVAKRQDVSMNGLVREAIDRALADSGSTFDDIDAVVVGKAPDFFE
GVMMPELFMADAMGATGKPLIRVHTAGSVGGSTGVVAASLVQSGKYRRVLALAWEKQSES
NAMWALSIPVPFTKPVGAGAGGYFAPHVRAYIRRSGAPAHIGAMVAVKDRLNGSRNPLAH
LQQPDITLEKVMASQMLWDPIRFDETCPSSDGACAVVVGDEEIADARLAQGHPVAWIHGT
ALRTEPLAFAGRDQVNPQAGRDAAAALWKAAGITSPIDEIDAAEIYVPFSWFEPMWLENL
GFAREGEGWKLTEAGETAIGGRLPVNPSGGVLSANPIGASGLIRFAEAAIQVMGKAEARQ
VPGARKALGHAYGGGSQYFSMWVVGCEKPKQAAA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggccggaaagctggccgccgtactcggcaccgggcagaccaagtatgtcgccaagcgc
caagacgtttcgatgaacggtctggtgcgggaggccatcgaccgagcgctggcggattcc
ggttccaccttcgacgacatcgacgccgtcgtggtcggcaaggcgcccgacttcttcgaa
ggggtgatgatgccggagctattcatggccgacgccatgggcgcgaccggcaagccgctg
atccgggtacacaccgccggttcggttggcggatccaccggggtagtggctgccagcctg
gtgcaatccggcaaataccgccgggtcctggcattagcctgggaaaagcagtcggaatcc
aatgccatgtgggcgttgtcgattcctgtgccgttcaccaaaccggtcggtgccggtgcg
gggggatacttcgccccgcatgtccgggcctatatccgccgctcgggcgcaccggcacac
atcggtgctatggttgcggtcaaggaccggctcaacggcagccgcaacccgttggcacat
ctgcagcagcccgacatcaccctggagaaggtgatggcatctcagatgctctgggatcca
atacgtttcgatgagacgtgcccgtcgtcagacggtgcgtgcgcggttgtcgtcggcgac
gaggagatcgccgacgcgcgactggcgcaagggcatccggtggcctggattcatggcacc
gcattacgcaccgagccgctggctttcgccgggcgcgaccaggtcaacccgcaggccggc
cgcgacgcggcggcggcgctgtggaaggccgcgggcatcaccagccccatcgacgaaatc
gacgccgccgaaatttacgtcccgttctcctggttcgagccgatgtggttggagaatctg
ggatttgcccgcgagggcgagggctggaagctcaccgaggccggcgagactgcgatcggc
ggtcgactaccggtgaacccttccggcggcgtgctgtccgccaatccgatcggcgcatcg
ggcctgatccgcttcgccgaggccgcgatccaagtcatgggcaaggcggaggcgcgtcaa
gttccgggtgcgcgaaaggccttggggcacgcttacggtggcggctcgcagtacttctct
atgtgggtggtcggctgcgagaaacccaaacaggcagccgcataa

DBGET integrated database retrieval system