KEGG   Mycobacterium tuberculosis variant bovis BCG Pasteur 1173P2: BCG_3630cHelp
Entry
BCG_3630c         CDS       T00463                                 

Gene name
nat
Definition
(GenBank) Arylamine n-acetyltransferase nat
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
mbb  Mycobacterium tuberculosis variant bovis BCG Pasteur 1173P2
Pathway
mbb00983  Drug metabolism - other enzymes
mbb01100  Metabolic pathways
mbb01110  Biosynthesis of secondary metabolites
mbb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mbb00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    BCG_3630c (nat)
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    BCG_3630c (nat)
   00983 Drug metabolism - other enzymes
    BCG_3630c (nat)
Enzymes [BR:mbb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     BCG_3630c (nat)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-ProteinID: CAL73619
UniProt: A0A0H3M9E9
Structure
PDB: 

Position
complement(3986223..3987074)
Genome map
AA seq 283 aa AA seqDB search
MALDLTAYFDRINYRGATDPTLDVLQDLVTVHSRTIPFENLDPLLGVPVDDLSPQALADK
LVLRRRGGYCFEHNGLMGYVLAELGYRVRRFAARVVWKLAPDAPLPPQTHTLLGVTFPGS
GGCYLVDVGFGGQTPTSPLRLETGAVQPTTHEPYRLEDRVDGFVLQAMVRDTWQTLYEFT
TQTRPQIDLKVASWYASTHPASKFVTGLTAAVITDDARWNLSGRDLAVHRAGGTEKIRLA
DAAAVVDTLSERFGINVADIGERGALETRIDELLARQPGADAP
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggcactggatctgaccgcgtacttcgatcgcatcaactatcgcggcgctaccgatcca
accctggatgttctgcaggatctggtgaccgtgcacagtcgaacgattccgttcgagaac
ctcgacccgctgctgggggtgccggtcgacgacctcagtccacaggcgctggccgacaag
ctggtacttcggcgccgaggcgggtactgctttgagcacaacgggctgatgggttatgtg
ctggccgaactcggctatcgggtgcgccgattcgccgcccgcgtcgtctggaagctcgcg
ccggacgcgcccctgccgccgcagacgcacaccctgctgggggtcacgttccccggctcg
ggcggatgctatctcgtcgacgtcggattcggcggccaaacaccgacctcaccgcttcgc
ctcgaaaccggcgccgtccagccgacaacgcacgaaccttatcggctcgaggaccgcgtc
gacggctttgtcttgcaggcgatggtccgggacacatggcagacactgtacgaattcacc
acccagacccgcccgcagatcgatctgaaagtggccagctggtacgcctcaacacacccg
gcatcgaagttcgtcacgggactgaccgccgcggtgatcaccgacgacgcccggtggaac
ctatctggccgcgaccttgccgttcaccgtgccggtggtaccgagaagatccgccttgcc
gatgcggcagcggttgtcgacaccctgagcgaacggttcgggatcaacgtggcagatatc
ggcgagcgcggcgcgctcgagacgcgcatcgacgagctattggctcggcagccaggagcc
gatgcgccgtaa

DBGET integrated database retrieval system