KEGG   Melittangium boletus: MEBOL_000032Help
Entry
MEBOL_000032      CDS       T05066                                 

Definition
(GenBank) siroheme synthase
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
mbd  Melittangium boletus
Pathway
mbd00860  Porphyrin and chlorophyll metabolism
mbd01100  Metabolic pathways
mbd01110  Biosynthesis of secondary metabolites
mbd01120  Microbial metabolism in diverse environments
Module
mbd_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mbd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MEBOL_000032
Enzymes [BR:mbd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     MEBOL_000032
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     MEBOL_000032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 Sirohm_synth_M Shikimate_DH ThiF BPD_transp_1 Aldolase 2-Hacid_dh_C Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: ATB26604
UniProt: A0A286SGF7
Position
complement(38018..38659)
Genome map
AA seq 213 aa AA seqDB search
MSAHVDFPVCLRLAGKRVLLVGAGTIADERSQQLVEAGARVRVVAPVVSPRIQRLAEAGR
LELIERVWRPEDTLEQQLVFVATDDPEVSRAVAAEARARGLWLNTADVPELCDFTLPSVG
RRGPLVVAVSTSGLAPALARVLRQQFLEQVTPGHVRLARLSGWLRKRLPRGAARMRLLKH
LVEGEAGALLVRGERRAAWARVRAALETFGETT
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgcatgtggattttcccgtctgtcttcggctggcgggcaagcgggtgctgctg
gtcggggcggggacgatcgccgacgagcggagccagcagctcgtggaggcgggagcccgg
gtgcgcgtggtggcgcccgtcgtgagtccgcgcatccagcggctcgcggaggcgggacgg
ttggagttgatcgagcgcgtctggcggcccgaggacaccctggagcagcagctcgtgttc
gtggccacggacgaccccgaggtgagccgggcggtggcggccgaggcgcgcgcgcggggc
ctgtggttgaacacggcggacgtgcccgagctgtgtgacttcacgctgccctcggtgggc
cggcgcggtcccctcgtcgtggcggtgtccacctcggggctggcgcccgcgctggcgcgt
gtgctgcgtcaacagttcctggagcaggtgacgcccggacatgtgcggctggcccggctg
agtgggtggttgcgcaagcggctgccccggggggccgcgcggatgcggctgctcaagcac
ctggtggagggcgaggcgggggcgttgctggtgcgaggcgagcgccgggccgcgtgggcc
cgcgtgcgcgccgcgctcgagacctttggagagacgacatga

DBGET integrated database retrieval system