KEGG   Melittangium boletus: MEBOL_000405Help
Entry
MEBOL_000405      CDS       T05066                                 

Definition
(GenBank) phosphatase
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
mbd  Melittangium boletus
Brite
KEGG Orthology (KO) [BR:mbd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MEBOL_000405
Enzymes [BR:mbd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     MEBOL_000405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP TPP_enzyme_C peroxidase
Motif
Other DBs
NCBI-ProteinID: ATB26970
UniProt: A0A250I701
Position
491953..492789
Genome map
AA seq 278 aa AA seqDB search
MIDLHSHTTASDGQHSPTDLVALAAQAGVTALAVTDHDTVEGLAEATEAARARGVELVPG
IELSAFVNKREVHILGHFVRPDFPALAQYAARLRVEREERMVRMVERLQGMGFPLQMEEV
RALAGGAQLGRPHLARVMVERRWCLDVKQAFDRFLGAGKPAWVERFKLDGKDAIHLIHQA
GGTATLAHPGSSKLERYDILLLARAGLDGLEALHSDHNPSVQQRYMKFAKEFDLVPTGGS
DFHGEQVTPGRRPGDSPTPAENFARLRARASNPHPRTS
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtgattgatctgcattcccacaccaccgcgagcgatggccaacactcgcccacggacctg
gtggccctggcggcccaggccggggtgacggcgctggcggtgacggaccacgacacggtg
gagggcctggcggaagccacggaggcggcgcgggcgcgcggcgtggagttggtgccgggc
atcgagctgtcggcgttcgtgaacaagcgcgaggtgcacatcctcggacacttcgtgcgg
ccggacttccccgccctggcgcaatacgcggcgcgactccgggtggagcgggaagaacgg
atggtgcgaatggtggaacggctccagggcatgggctttcccctccagatggaggaggtg
cgggcgctcgcgggcggcgcccagctgggccggccccacctggcgcgggtgatggtggag
cggcgctggtgcctcgacgtgaagcaggccttcgaccgtttcctcggggcgggaaaaccc
gcctgggtggagcgtttcaagctggacggcaaggacgccatccacctcatccaccaggcc
ggagggaccgcgaccctggcgcatccgggaagttcgaaactggagcgttacgacatcctg
ctcctggctcgcgcggggctggatggcctggaggccctacactcggaccacaacccgagc
gttcagcagcggtacatgaagttcgccaaggagttcgatctggttcccaccggaggcagt
gacttccatggggagcaggtgacacccggacggcgcccgggggattctcccactccggcg
gaaaacttcgcgcggctgcgcgcacgggcctccaacccgcatccacgaacgagctga

DBGET integrated database retrieval system