KEGG   Melittangium boletus: MEBOL_001179Help
Entry
MEBOL_001179      CDS       T05066                                 

Definition
(GenBank) nitrilase/cyanide hydratase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
mbd  Melittangium boletus
Brite
KEGG Orthology (KO) [BR:mbd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MEBOL_001179
Enzymes [BR:mbd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     MEBOL_001179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: ATB27734
UniProt: A0A250I789
Position
1419437..1420240
Genome map
AA seq 267 aa AA seqDB search
MHLLAAAQMVSTADKAHNLDSAIRLVRRAADLGARLVGLPENFSWMGPEAERSAAAETLE
GPTLSRMAEVARERRVTLLAGSILEQGAPGGRLYNTTVVLGPDGSRQAVYRKIHLFDVDV
GDGTPYRESAAVAPGEDVVVTDTELGRLGLSICYDLRFPELYRRLAREGATLLAVPAAFT
LMTGKDHWEVLLRARAIENQCYLFAPAQGGRHSAQRVTWGHAMVVDPWGLVTARASEGEG
LAVAAVDPELLARIRRNLPCLQHRRLE
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcacctgctcgccgctgctcagatggtgtccaccgcggacaaggcccacaacctcgat
tccgccatccggctcgtccgaagggcggccgacctgggggcccgactcgtgggcctgccg
gagaatttctcctggatggggcccgaggccgaacgctccgccgccgccgaaaccctcgag
ggacccacgctctcgcgcatggccgaggtggcgcgcgagcggcgcgtgacgctcctggcg
ggctccatcctggagcagggcgcgccgggaggtcgcctctacaacaccacggtcgtcctg
gggccggatggatcgcgccaggcggtgtaccgcaagatccacctgttcgacgtggacgtg
ggcgacggcacgccctatcgcgagtccgcggcggtggccccgggcgaggacgtggtcgtg
acggacacggagctcgggcggctgggcctgtccatctgctacgacctgcgctttcccgag
ctctaccggcgcctggcgcgcgagggcgccacgctgctcgcggtgcccgcggccttcacc
ttgatgacgggcaaggaccattgggaggtcctcctgcgcgcgcgggccatcgagaaccag
tgctacctcttcgctccggcccagggcggacggcactcggcccagcgcgtcacctggggc
cacgccatggtggtggacccctggggcctggtgacggcccgggcctcggagggcgaggga
ctggccgtggcggcggtggaccccgaactgctcgcgcgcatccgccggaatctgccctgt
ctgcaacaccgtcggctggagtga

DBGET integrated database retrieval system