KEGG   Melittangium boletus: MEBOL_006874Help
Entry
MEBOL_006874      CDS       T05066                                 

Definition
(GenBank) succinate--CoA ligase subunit alpha
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
mbd  Melittangium boletus
Pathway
mbd00020  Citrate cycle (TCA cycle)
mbd00640  Propanoate metabolism
mbd00660  C5-Branched dibasic acid metabolism
mbd01100  Metabolic pathways
mbd01110  Biosynthesis of secondary metabolites
mbd01120  Microbial metabolism in diverse environments
mbd01130  Biosynthesis of antibiotics
mbd01200  Carbon metabolism
Module
mbd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mbd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mbd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MEBOL_006874
   00640 Propanoate metabolism
    MEBOL_006874
   00660 C5-Branched dibasic acid metabolism
    MEBOL_006874
Enzymes [BR:mbd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     MEBOL_006874
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: ATB33382
UniProt: A0A250IQ60
Position
8365339..8366238
Genome map
AA seq 299 aa AA seqDB search
MSILVNENTKVLCQGITGSAGSFHTKQMLEYGTKMVGGVTPGKGGTDFEGKVPVFNTVAD
AVKQTGANTSVIFVPPPFAADSIMEAADAGISLIITITEGIPVNDMVRAKRYIQGKPGVR
LIGPNCPGVITPGAKCKIGIMPGHIHKPGRIGVVSRSGTLTYEAVHQLTQLGLGQSTAVG
IGGDPVNGTDFVDVLKLFNDDPETDAVIMIGEIGGSAEEAGAEYVAREFKKPIAGFIAGQ
SAPPGKRMGHAGAIISGGKGTASEKIKAMEAAGFVMAASPAELGTTLQEAIKRGPAKKR
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcctcgtcaatgagaacacgaaggtcctctgccagggcatcaccggctcggcg
ggttcgttccacaccaagcagatgttggagtacggcacgaagatggtcggtggtgtgacg
cccggcaagggcggcaccgacttcgagggcaaggtccccgtgttcaacacggtggccgac
gcggtgaagcagaccggcgcgaacacctcggtcatcttcgttccgccccccttcgccgcg
gactccatcatggaggccgccgacgcgggcatctccctcatcatcaccatcaccgagggc
atccccgtcaacgacatggtgcgcgccaagcgctacatccagggcaagccgggcgtgcgc
ctcatcggccccaactgcccgggcgtcatcacccctggcgccaagtgcaagatcggcatc
atgccgggccacatccacaagccgggccgcatcggcgtggtgtcgcgctcgggcacgctc
acctacgaggccgtgcaccagctcacccagctgggcctgggccagtccaccgcggtgggc
atcggtggcgatccggtcaacggcacggacttcgtggacgtgctcaagctcttcaatgac
gacccggagacggacgccgtcatcatgatcggcgaaatcggcggtagcgccgaggaggcc
ggtgccgagtacgtggcgcgtgagttcaagaagcccatcgcgggattcatcgccggccag
tcggcgcccccgggcaagcgcatgggccacgcgggcgcgatcatctccggaggcaagggc
accgcctccgagaagatcaaggccatggaggccgcgggcttcgtgatggccgcgagcccc
gccgagctcggcaccacgctgcaggaggccatcaagcgtggccccgcgaagaagcgctag

DBGET integrated database retrieval system