KEGG   Melittangium boletus: MEBOL_007357Help
Entry
MEBOL_007357      CDS       T05066                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
mbd  Melittangium boletus
Pathway
mbd00564  Glycerophospholipid metabolism
mbd01100  Metabolic pathways
mbd01110  Biosynthesis of secondary metabolites
Module
mbd_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:mbd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    MEBOL_007357
Enzymes [BR:mbd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     MEBOL_007357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase BAH PTS_EIIA_1 HlyD_3
Motif
Other DBs
NCBI-ProteinID: ATB33856
UniProt: A0A250ISE2
Position
complement(8961572..8962414)
Genome map
AA seq 280 aa AA seqDB search
MNEQNFMKLMQILPKSALSTAVGMATRLPVPAPLHRAAIKTFAKLYNVDAAEAEHALEHY
PTFAEFFTRGLKVGARPIDPGEKVVVSPVDGAVSQVGYSEHGRVLQAKDIHYTVGELLGD
EAAAKPFHGGAWTTIYLSPRDYHRIHAPLGGTVTGYAYIPGEFWPVNPASVKNKKSLFCV
NERLITYLDTVAGKCAVVKVGATCVSRIKAAYEDVITHQGQPGKVHRYGTALPVEKGGEL
GRFEMGSTVILLFEPGRVKWDASLQPEAVVRLGRRIGEIP
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacagaacttcatgaagctcatgcagatcctccccaagtccgctctgtccacg
gcggtggggatggccacgcgcctgcccgtgcccgcgccgttgcaccgggcggcgatcaag
acgttcgcgaagctctacaacgtggacgccgccgaggccgagcacgccctggagcactac
cccacgttcgcggagttcttcacccgggggctcaaggtgggcgcgcgccccattgatccg
ggcgagaaggtggtcgtgtcccccgtggatggcgccgtgtcccaggtgggctactccgag
cacggccgggtcctgcaggccaaggacatccactacacggtgggggagctgctcggggac
gaggcggccgcgaagcccttccacggcggcgcctggacgaccatctacctgtcgccgcgg
gactaccaccgcatccacgcgccgctcggcggcaccgtcaccggctacgcctacatcccg
ggcgagttctggcccgtgaaccccgcgtccgtgaagaacaagaagtcgctcttctgcgtg
aacgagcggctcatcacgtacctggacaccgtggcgggcaagtgcgccgtggtgaaggtg
ggcgccacgtgcgtgtcgcgtatcaaggccgcctacgaggacgtcatcacccaccagggc
cagcccggcaaggtgcaccgctatggcacggcccttcccgtggagaagggcggggagctg
ggccgcttcgagatgggctccaccgtcatcctgctcttcgagccgggccgggtgaagtgg
gacgcgagcctgcagcccgaggccgtcgtgcgcctgggccgccgcatcggggagattccg
tga

DBGET integrated database retrieval system