KEGG   Marssonina brunnea: MBM_00710Help
Entry
MBM_00710         CDS       T03105                                 

Definition
(RefSeq) siroheme synthase
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
mbe  Marssonina brunnea
Pathway
mbe00860  Porphyrin and chlorophyll metabolism
mbe01100  Metabolic pathways
mbe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mbe00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MBM_00710
Enzymes [BR:mbe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     MBM_00710
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     MBM_00710
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sirohm_synth_C NAD_binding_7 Sirohm_synth_M
Motif
Other DBs
NCBI-GeneID: 18756645
NCBI-ProteinID: XP_007288599
UniProt: K1X9C1
Position
Unknown
AA seq 275 aa AA seqDB search
MGADKFPEVEGGGSLILAWQIRNKRVLVVAAGRILNVLNADAKVTVVSPRAGLNPEVAYR
IEKGQVDYVDRKFEAADLDNVDMVLTAVDDPVASTEIWKLCKERRIAANIADVPPECDFY
FGSIHRDGPLQIMVSTNGKGPRLANIVRRSIAEKLPPNIGDAILKVGRLRQKLRQVAPNP
EEGPKRMSWMIKVSDAYSLEDLCEMREEDMEILLRFYGPDKVPRFGCLKAIEGNDVETLL
APYAPGQIPPAGCPKALERQWDAFDGSFGFCVGCG
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgggcgccgataagtttcctgaggttgagggcggcggctccttgattctggcatggcag
atccgtaacaagagggttttggtggttgcggcaggacggatcctgaacgtgctcaatgca
gacgccaaagtcaccgtggtgtctccccgcgcaggcctgaatcccgaagtggcatatcgc
atcgagaagggccaggtcgactacgtggaccggaagttcgaagcggcggatctcgacaat
gtcgatatggtcttgacggcagtggacgatccggtcgcctcgacggagatatggaagctg
tgcaaggagaggaggattgcagccaatatcgccgatgtgccacctgaatgcgacttctac
tttggaagcatacatcgggatggaccgctgcagatcatggtcagcaccaacggcaaaggg
ccgcgactggcgaatattgtgcggaggtccatcgccgaaaagctgcccccgaacattgga
gatgcgatcttgaaggttggacggctgaggcagaagctgagacaggtcgcgcccaaccct
gaggagggacccaagaggatgtcgtggatgatcaaggtcagcgacgcctacagcttggag
gacctatgtgagatgcgcgaagaggacatggaaatactgctacgattctacggcccggat
aaggtacctcgatttggatgtctcaaggccattgaagggaacgatgtggaaacgctgtta
gcaccttatgctcctggccaaatacctccggccggctgtcccaaagctctggagagacag
tgggatgcttttgacggctcttttggattctgtgttgggtgcggatag

DBGET integrated database retrieval system