KEGG   Marssonina brunnea: MBM_02142Help
Entry
MBM_02142         CDS       T03105                                 

Definition
(RefSeq) phosphoglycolate/pyridoxal phosphate phosphatase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
mbe  Marssonina brunnea
Brite
Enzymes [BR:mbe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     MBM_02142
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2 Acid_phosphat_B
Motif
Other DBs
NCBI-GeneID: 18758077
NCBI-ProteinID: XP_007290031
UniProt: K1WRD3
Position
Unknown
AA seq 304 aa AA seqDB search
MAASPKYLSGDSAAIREFIDEFDIFLLDCDGVLWSGDHLFPGTVETLEFLRSQGKKIVFV
TNNSTKSRADYQKKLTSMGIPSDVEEIFASAYSSAIYISRILKLPGPKNKVFVMGESGIE
TELKSEGIEFIGGTDPAYRRDITPEDYTGIADGSLLDDNVGVVLAGLDFHVNYLKLSHAY
HYIKRGAVFLATNLDSTLPNSHSFFPGAGSIVIPLINMSKQQPTALGKPSQAMMDSIEGK
FQFDRKKACMVGDRLDTDIKFGIEGKLGGTLAVLTGVSKKEQWEAEDAAAVPAYYVEKLS
DLKG
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggcagcctctccaaagtatctctccggagattcagctgcgatccgcgagtttatcgat
gagttcgacatctttctacttgattgtgatggagtactctggtctggagaccacctgttc
cccgggactgtcgagacgctggagttcttgagatctcaaggcaagaaaatcgtcttcgtc
accaacaactcgacgaaatcccgagcggactaccagaagaagctcacatctatgggcata
cccagcgacgtcgaggaaatcttcgcatcggcctactcctccgccatctacatctcccgc
atcctcaagctcccaggaccaaagaacaaagtcttcgtaatgggcgagagcggcatcgag
acggaattgaagagcgagggtattgagtttattggaggaacagaccctgcctatcgacga
gacatcacaccagaggactacactgggattgcagatggatctttgctggacgataatgtg
ggcgtcgtgctagctggtctggattttcacgtcaactacctgaagctctcgcatgcctat
cactatatcaaacgcggagcggtgttcctggctaccaacctcgacagcacgctacccaac
agccacagtttctttcctggtgcgggctcgatagtcatcccgctcataaatatgtctaaa
caacagcccacggcattgggcaagccgagtcaggcaatgatggattcaatagaggggaag
ttccagtttgaccgtaagaaggcgtgtatggttggagacaggcttgacactgatatcaag
ttcggtattgagggcaagcttggaggaacgctggctgtcctgacgggagtcagcaagaag
gaacaatgggaagctgaagatgctgcggccgttccagcttattatgttgagaaactgagc
gatctgaagggttga

DBGET integrated database retrieval system