KEGG   Marssonina brunnea: MBM_02441Help
Entry
MBM_02441         CDS       T03105                                 

Definition
(RefSeq) pyruvate decarboxylase
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
mbe  Marssonina brunnea
Pathway
mbe00010  Glycolysis / Gluconeogenesis
mbe01100  Metabolic pathways
mbe01110  Biosynthesis of secondary metabolites
mbe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mbe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MBM_02441
Enzymes [BR:mbe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     MBM_02441
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C E1_dh RPE65
Motif
Other DBs
NCBI-GeneID: 18758376
NCBI-ProteinID: XP_007290330
UniProt: K1Y252
Position
Unknown
AA seq 640 aa AA seqDB search
MSTITLAEYLYTRLHQLKVRSLHGVPGDYNLVALDYVEKAGLTWVGNCNELNAGYAADGY
ARVNGVGAMATVIGVGELSAINACAGSYAENVPVVYIVGSPATAARKNRLVLHHTLGDGE
FDVFADMFKRVTVAQTYLDDITTAAQEVDRVLEQCWIQKRPVYIRLPTDMATKPLDKTLL
DIPLNLEPVANNADAELSVVETLLELIHSSKRPVFLVDANVSRYRVLEEVDALVRKSGIP
TFVAPMGKGNVTESLENFNGMYFGAHSDESIRKAVETSDLVVWIGPVKSDVNTAFFTAKL
PERIIELHNDRIEILGTKHEGMQMRGVLQKLGARIETSPPHSPKLGALSESGSTASLADK
QAREPILHDHLWKRLSSWFQPNDVIITENGTANIGIWDSKLPSGVQAINQTLWGSIGYTV
GAAQGAALALKDVGSDARTILFVGDGSFQLTAQEVSTMIRHKLSVTIFLIENEGYTIERF
IHGMDAEYNDISGWKYKEIPRVLGAREGDVTVHDVKTKQELEVLLLNEEFAHAKNVQFVE
LHMPKEDAPYNLKLQIKSNLQVKSTNPPYFHSFIITKGYQGDGGGEIRGGIEGLLFAAAD
VGLGRRFGGLLAAEVVPGRLLLLLLSWWMGGRKRGVRSEK
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacaatcactctagccgagtatctgtacacacgccttcatcaattgaaagtccgc
tcccttcatggtgtaccgggagactacaatctggttgctttagattacgtggagaaagct
ggcttgacatgggttggcaactgcaatgaactcaatgcagggtatgcagcagatgggtat
gcgagagtgaatggggtcggcgcaatggccacggtcatcggggttggagagttatcagcc
atcaatgcctgtgccggctcctatgcagaaaatgtcccggtggtctacatcgtcgggtcg
ccagcgacggctgcacggaagaacaggctcgtcctccatcacactctcggcgatggagaa
ttcgatgtgttcgcagacatgttcaagagggttacggtggcacaaacctatcttgacgat
atcaccaccgcagctcaggaggtggatcgggtgctggagcagtgctggatccagaagaga
cctgtatacatccggttgccaacggacatggcgacgaagccgttagataagacccttttg
gacatcccgttgaacctggagccggttgcgaacaacgctgatgccgagctttccgtggtc
gaaaccctcctcgaactgatccattcgtccaagaggccggtcttcctggttgacgctaat
gtttccagatacagagttctggaagaggtcgatgccctcgttcgcaaatccggaatcccg
acatttgtggcaccaatgggcaagggtaacgtcaccgaatcactcgagaacttcaacggc
atgtattttggcgctcactcagatgagagcataagaaaggcagtggagacctcggatcta
gtagtgtggattggtcccgtcaaaagcgacgtcaacacagcattttttacagccaagctt
ccagagagaatcatcgagcttcacaacgatcgaatcgagatacttggcaccaaacacgag
ggcatgcagatgagaggggttctccagaagctcggtgctcgtatcgagacgtcgccgcct
cactcgccgaaacttggcgcgctaagcgagagcggatcaacagcatcacttgcggacaag
caagcacgggagccaatactgcacgatcacctgtggaagagactctcctcatggttccag
ccaaacgacgtcatcatcaccgagaacggcacagccaacattggaatctgggacagcaag
ctccccagcggcgtgcaggccatcaaccaaacgctctggggctcaatcggctacaccgtc
ggcgccgcacagggagcggccctcgctctcaaggatgtcggctcggatgctaggactatc
ctgttcgtgggagatggctccttccaactcaccgcgcaagaagtgtcgaccatgatccgg
cacaagctcagcgtcaccatcttcctgatcgagaacgaggggtacaccatcgagcggttc
atccacggcatggacgccgagtacaacgacatctccgggtggaagtacaaggagatcccg
cgagttctcggggctcgagaaggtgatgtcacggttcacgatgtgaagacgaagcaggag
ctggaggtcctgctgctgaacgaggagtttgctcacgcgaagaatgtgcagttcgtggag
ctgcacatgccaaaggaggatgcgccgtacaacttgaagcttcaaatcaaatcaaacctc
caagtcaaatccaccaacccaccatactttcattcattcataattactaagggctaccaa
ggtgatggtggtggggaaatacgtggcggtatcgagggtctgctgtttgctgctgcggat
gtcgggttggggaggaggtttggtggcttgctggctgcagaggttgttccaggcaggctg
ctgctgctgctgctgagttggtggatgggagggcgaaagagaggggtccgaagtgagaag
tga

DBGET integrated database retrieval system