KEGG   Marssonina brunnea: MBM_03017Help
Entry
MBM_03017         CDS       T03105                                 

Definition
(RefSeq) nuclear import and export protein
  KO
K14289  exportin-5
Organism
mbe  Marssonina brunnea
Pathway
mbe03013  RNA transport
Brite
KEGG Orthology (KO) [BR:mbe00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    MBM_03017
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mbe03016]
    MBM_03017
   03036 Chromosome and associated proteins [BR:mbe03036]
    MBM_03017
Transfer RNA biogenesis [BR:mbe03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    MBM_03017
Chromosome and associated proteins [BR:mbe03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Other miRNA pathway proteins
     MBM_03017
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Xpo1 IBN_N PXA Sipho_Gp157
Motif
Other DBs
NCBI-GeneID: 18758952
NCBI-ProteinID: XP_007290906
UniProt: K1WM54
Position
Unknown
AA seq 1139 aa AA seqDB search
MNGSANGHRITSDHEVTTLSGGSTISLPQIHEALEIVHGTYSSNNSRREAGIFLDNVKNN
AEAPYHGFTLASDKGQQPVVRHFALSLLEHAIKYNWQEYSEAQETALRGWILQLSQDVSP
EDPLYLRNKTAQLWVEIAKRSWASEWLDMDELLVRLWEVPGSVVHKEFVLFILETLSEEV
FNGEDTVAVLREGALSKACVEIFTPAIVLAEAFPNRRPGTPVRYGEEGWLMISNLGSFIE
TKISAIPENCDLPNLLNLFLAIAQSQSFVVSIPLLVTWTRLLRSDTIGSSPTITPLIAPL
LELCSSRLIRYESLPEDYDDPTLIFLLEDIDTIPERHAFLGNYRRYSVTILECIVRQKRS
EAIYHILGQVDQSMRQLYDGQPPFSMESYAKTSMPVLRTDAHFAVVEATLKGYMKWRSSH
GSKPLQDVKHSTGCTSESHAKINQEQERSAIESNIEAWCERLLELNYEDPIIRKRILQLL
VAFSTTALDTKTPFMLKVLEYILMSRPVERPEYPAYNDAVKELQADGVYELQRIATKMPD
QLLDVYEQLEAKVNEIISSGTLDLKRQTSYQTFLFTIILRASKIDHDMRVQKLLAFVNPV
KQLWQNQEMEQALASFGGFSEMLGLSKVREYLASRRVHEIDEWGLYQLDVEGQSIQKELE
ERLKALPLRTTKSFLASSTEKVEKDSPPYKVSLVLWREALPVILPNLLKFLSHAHAFHNT
ANWAGLPPDMQIVVNRILTDRFWQAGISEGSKDDFYARVSGTRQTMEGFASSIRGTIRTI
REACYSILWCMSRLGMDFYGFSELPGPLAHSLFADADCLSSHQLIALLSVVRLLVDDCPV
ELRSHFVPPILATCFVQMDAKCSSEWEKLARKQVAASDGDNLTEEMKEESILRQLTHSAV
MMIGGMLDPARPNPGASATTAKDSSTYENTNPVSAYPSMRTFCLTSSTILEPLLMFLTHA
IRMRDSRCCGVVLRIFRSLVPDFVSQDAPLSSTIREFISTDVLKACISSLNEPYFVELQR
ELATVVGSVLIYYSKLTPTPRQILVSIPGVQESAVDKCIEYITRPGMLQRQQRALVLDLL
RDIKGVSISEQGRIAKSTPAVRQQNRSKMQQEFMKEQPAPEPRKASPSLEGVASMFVEL
NT seq 3420 nt NT seq  +upstreamnt  +downstreamnt
atgaacggctctgccaacgggcacagaatcaccagcgatcacgaagtaaccaccctcagc
ggcggtagcacaatctcgctgcctcagatccacgaagctctcgagatagtccacggtacc
tactcgtcgaacaactcccgccgtgaagctggtatcttcttggataacgtcaagaataac
gccgaggcgccctaccatggcttcactttagcctccgacaagggccagcagcccgtggtg
cgccactttgccctctccctcctcgagcatgcgataaaatacaattggcaagaatactcg
gaggcacaggagacagcgttgcggggatggattctgcagctatcacaagacgtttcgcca
gaggacccgctgtatctgcggaataagacggcgcagttatgggttgagattgcaaagagg
agctgggcttcagagtggctcgatatggatgagctgctagtacggctctgggaggtgcct
ggatcggtggtgcacaaggaatttgtgctattcattctagagacactttcggaagaggtc
ttcaatggagaagatacagttgcggtactgagggagggagcgctcagcaaggcatgcgta
gaaatttttacgccagccattgtccttgctgaagccttcccaaaccgtcggccggggact
ccggtacgatatggggaagaggggtggctgatgatatcgaatcttggtagctttattgag
acaaaaatctcggctattcccgaaaattgcgacttgcccaacctcctcaatctctttctt
gctattgctcaaagccaaagctttgtcgtttcaatacctcttctcgttacttggacccgg
cttcttcgttcagataccattggcagctctcccaccatcacccctctaattgcacctctg
cttgagttatgcagctcaagattaatacgctacgagagtcttcccgaagactacgatgat
ccgaccttaatattcttactcgaggatattgacacaatccccgagcgacacgcgttcctt
ggtaactaccgacggtacagtgtgacaattctggaatgcattgtccgtcaaaagagatca
gaagccatctatcacattttgggtcaggttgaccaatcgatgcggcaactctacgacgga
cagcctccgttctcaatggaatcttacgccaaaacatcgatgccagtcttgcggacggac
gctcacttcgctgttgtggaggccacgttgaaaggctacatgaagtggagatcatcacac
ggatccaaacctttgcaagatgtaaaacactctactgggtgcactagtgagtcccatgct
aagattaaccaggagcaggaacgtagcgcgatagagagtaacattgaagcgtggtgcgag
cggctgctcgaattgaactacgaggatccaatcattcggaagcggattcttcagcttctt
gttgcattttcgacaacagccctagatacaaagacaccgtttatgctcaaggttttagag
tacattttgatgagcagacctgtggaacgaccagaataccctgcttacaacgacgccgtg
aaagagttacaagcagatggcgtttatgagttacaacggatagcgaccaaaatgcctgac
caacttctggatgtctatgagcagcttgaagcaaaagtaaacgagatcatatcttctgga
acattagacttgaagcggcaaacttcttaccaaactttccttttcaccatcatccttcgc
gcctcaaagatagaccacgacatgcgcgtgcaaaagctcctcgcattcgtcaaccccgtg
aagcagctatggcaaaatcaagaaatggagcaagctttagcttcatttggaggcttttcc
gagatgcttggtcttagcaaggtcagagaatacctcgcttcgcggcgggttcatgagatc
gatgagtgggggctgtaccagctcgatgtggaaggccagtcgatccagaaagagctggaa
gagcgactaaaggctctgccgctgcggacaaccaaatcttttctagcttcttcgacggaa
aaggttgagaaggacagcccaccttacaaagtatcacttgtgttgtggcgtgaagctcta
ccagttattcttccgaatttgctaaagttcttgagccatgcacacgccttccataacaca
gccaactgggcgggccttcctcccgatatgcaaatagtggtcaatcgcatcttaacggac
cgtttttggcaagccggcatatcagaggggagcaaagatgacttctatgctcgggtatca
ggtaccagacagaccatggaaggtttcgcttcctcgattcgtggcaccatccgcactatt
cgagaggcttgctactctatcctctggtgtatgagcagactaggcatggacttctatggc
ttcagtgaactacctggcccattagcgcattcgctttttgccgatgcggattgtctctct
tcgcaccagctcattgcgctgctcagtgtggttcgtttgctggtagatgactgcccggtt
gagctccgcagccacttcgtcccgccgatattggcgacttgctttgtccaaatggacgca
aagtgcagctcagagtgggagaaacttgctcggaagcaggttgcagctagcgatggtgat
aacctcaccgaggaaatgaaggaggagagcatcttgcggcaattgacacattctgcagtc
atgatgattggcggaatgttagatcctgcacgtcccaatcctggtgcaagtgctacaacg
gcgaaagattcgtccacgtacgaaaacaccaatccagtatctgcctatccgtcgatgcgc
acattctgtcttacttcatcaactattctcgagcctttgctcatgtttcttacccacgcg
attcggatgcgcgatagtcgatgctgtggtgtcgttctccgaatcttccgttccctcgtc
cctgatttcgtctctcaagatgcacctctctcgtctaccatccgagagttcattagcacg
gatgtacttaaagcctgcatctcctcattaaatgagccttactttgtcgagctccaaaga
gaactcgcaacggtcgtcggctccgtcctcatctactactcgaaacttactcccactcca
cgccaaattctcgtcagcatccccggcgtccaagaaagcgcagtcgacaaatgcatcgaa
tacatcacccgcccaggcatgctgcagcgccagcagcgcgccttggtcctcgacctcctc
cgcgacatcaagggcgtaagcatcagcgagcaaggccgtatcgccaagtcaaccccggcg
gtacgacaacaaaaccggagtaagatgcagcaggaattcatgaaggagcagcctgcgccc
gaaccgagaaaggcctcacctagcttggagggtgtggcgagcatgtttgtggagctgtga

DBGET integrated database retrieval system