KEGG   Marssonina brunnea: MBM_05691
Entry
MBM_05691         CDS       T03105                                 

Definition
(RefSeq) BNR/Asp-box repeat protein
  KO
K18651  oligoxyloglucan reducing-end-specific cellobiohydrolase [EC:3.2.1.150]
Organism
mbe  Marssonina brunnea
Brite
KEGG Orthology (KO) [BR:mbe00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MBM_05691
Enzymes [BR:mbe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.150  oligoxyloglucan reducing-end-specific cellobiohydrolase
     MBM_05691
SSDB
Motif
Pfam: Sortilin-Vps10 BNR
Other DBs
NCBI-GeneID: 18761626
NCBI-ProteinID: XP_007293580
UniProt: K1WVA5
Position
Unknown
AA seq 807 aa
MMMLARICAAGAALAQLVHGKNSSSAYPLETQTFQYKYSSVAITGGGFITGIIAHPKEQA
LMYARTDIGSSYRWDGLQDQWVPLTDFISEADVNYLGTETFALDPTDPDRLYLAQGQYTN
QNNSAFFVSADRGATFEIYPAPFPMGANELGRNNGERLAVNPFNPSELYMGTRTQGLWKS
TDQAATWTNITNYPDASANGIGIVFVLFDPQNEGTIYAGATVPNGLYVTTDGGETWSSLP
GQPQDWEGVTTDPEHPPASTGPQPMKAALASNGLLYVTYADFPGPYGVQYGSVWSYNTTS
SQWTDITPGAGNSSPAPFTPQTFAPGGYCGLSVDGKDPNTLVVVSLDREPGPALDSMYLS
RDGGATWKDVTQLSSPPDTGGYWGHPIEQAALKDGTPVPWLSFNWQKPWGGYGAPSPIVG
LAKFGWWITAVLIDPFNSDHVMYGTGATIWSTDNLNRVEADQAPDWYIQAQGIELNAVLA
MISPTDGANLYSGLGDISGMRHDNLSVPQPMFGSPGFSNLDGLDWAGNAPNVITRSGASG
VSYEDGCGNGAYSTDGGLSWVKFLTCVPGVGTQTWVNGFIAVDASGQYFVWASRSSVAPA
NASGPYATSDFGKTWTSPQGLDVQTGNLCADKVQPQTFYAFDAGVWYISTDGGASYTSRP
ASETGLPDGAGAVPVVNFGQAGEVWLPLGSDGLWHTVNFGRTWTAMPGSLTTSQFSVGAP
APGGTGPALFLWGKVATEGAQGLYRSDDSGESWVRINDDAHQYGGPKRIVADTRVYGRVY
LGTFGRGMVYADIAGDGSGVLPGTFGI
NT seq 2424 nt   +upstreamnt  +downstreamnt
atgatgatgctggctcggatatgcgctgcgggtgcagctctcgcacagctagtccacggc
aagaatagcagctctgcctacccactggagacccaaacttttcagtacaagtacagttcg
gttgcgattaccggtggcgggttcatcacgggaatcatcgcgcacccgaaggagcaggct
ctcatgtacgcgagaacagatatcgggagttcgtaccgatgggacgggctgcaagatcaa
tgggttccgctcacggacttcatcagcgaggccgacgtcaactatctagggaccgagacg
ttcgccctcgaccccaccgatccggatcgtctgtacctggcgcagggacagtacaccaac
cagaacaactcggccttcttcgtgtcggctgaccgaggcgcaaccttcgagatctacccg
gcgccgttccccatgggggcgaacgagctgggacgtaacaacggcgagaggctggccgtc
aaccccttcaaccccagcgagctctacatgggcacgcgcacccagggactgtggaagtcg
actgatcaagcggcgacctggacgaatatcaccaactaccccgatgcgtccgcgaacggc
atcgggatcgtgttcgtcctgttcgacccgcagaacgagggcaccatctatgcgggagcg
accgtccccaacggcctctacgtgaccactgacggcggcgagacgtggagctcgcttcca
ggacagccacaggactgggaaggggtcacgactgaccccgaacatccacctgcaagcact
gggccccagcccatgaaagccgccttggcttccaatgggctattgtatgtcacgtatgct
gacttccccggtccgtatggggtgcagtatggctctgtgtggagctacaataccacatct
tcgcagtggaccgatatcacgcccggggctgggaactcctcccctgcccccttcacaccg
cagacctttgcgcctgggggctactgcggactgagtgtcgacggcaaggatccgaacact
ctcgtcgtagtctcgctggaccgcgaaccaggaccagcgctcgatagcatgtacctctct
cgtgatgggggcgcgacgtggaaagacgtgactcagctctcttcgccgcctgacacgggc
ggctactggggccaccccatcgaacaagccgccctcaaagacgggacgccggtcccctgg
ctcagcttcaactggcagaaaccatggggtggctacggggctccgtcccccatcgttggc
ctcgccaagtttggatggtggatcacggccgttctcattgaccctttcaactccgatcac
gtcatgtacggcaccggagccaccatctggtctaccgacaacctcaaccgggtggaggcg
gaccaggcgcccgactggtacatccaggcacagggtatcgagctgaatgccgtgctggcc
atgatctcccccactgacggggcgaatctctacagtggcctcggcgacatcagtggcatg
cgccacgacaacttgtctgtcccgcagccgatgttcgggtccccaggcttctccaatctc
gacgggctggactgggcaggcaacgcgccgaatgtcatcacccgctcgggagctagcggc
gtatcatatgaagacggatgtggcaacggcgcctactcgacagacggcggcctgagctgg
gtgaaattcctcacctgtgttccgggcgtgggtacccagacgtgggtcaatggcttcatc
gccgtcgacgcttccgggcagtatttcgtctgggcctctcgctcctcggtggcaccagcc
aacgcaagcggtccctacgcgaccagcgattttggcaagacctggacctcgccccaagga
ctggatgtccagaccggcaacctctgtgccgacaaagtgcagccgcagaccttctatgcc
ttcgacgccggcgtttggtatatcagcacagatggcggcgcatcctacacatcccgaccg
gcctcagagaccggcctgccggacggggcgggcgcggtacccgtagtcaactttggccaa
gcgggcgaggtctggctgcctctcggctcagacgggctgtggcataccgtaaactttggc
cgcacgtggaccgccatgccgggttcccttaccacgtcacagttctctgtcggagctccc
gctccgggagggacggggccagcgttgttcctctggggcaaagtggccacggaaggggcg
cagggcctctaccgctctgatgattccggcgagagctgggtccggattaacgatgatgca
caccagtacggagggcccaagcggatcgtggccgatacgagagtttatggacgggtgtat
ctggggacctttggcaggggcatggtttatgcggatatcgcgggtgatgggagcggggtg
ctgcctgggactttcggaatctag

DBGET integrated database retrieval system