KEGG   Marssonina brunnea: MBM_05956Help
Entry
MBM_05956         CDS       T03105                                 

Definition
(RefSeq) peptidase family M49
  KO
K01277  dipeptidyl-peptidase III [EC:3.4.14.4]
Organism
mbe  Marssonina brunnea
Brite
KEGG Orthology (KO) [BR:mbe00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mbe01002]
    MBM_05956
Enzymes [BR:mbe01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.4  dipeptidyl-peptidase III
     MBM_05956
Peptidases [BR:mbe01002]
 Metallo Peptidases
  Family M49: dipeptidyl-peptidase III family
   MBM_05956
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M49
Motif
Other DBs
NCBI-GeneID: 18761891
NCBI-ProteinID: XP_007293845
UniProt: K1WEQ1
Position
Unknown
AA seq 707 aa AA seqDB search
MDATEIKNFLADSPPSTVKLEIKKHFDALTDQQARYAHFISRAAFTGTRITLRQVSPESE
SIFDFIVELYKASNGDWKALQEKAGISAEELQQFLEYAAQFLGNCGNYKGFGDVKFVPRC
SEKAFDNLAAAAPKAGVHYKATKGAIFSSNKEGIMHLGYLDEGHMTTYYPDSKGITKADI
AAVSDYMEKIGLLVENTRLRKKTDGNFDLLIASAVTQVPEAGGDVGKNTEFEIDSGSLKG
KKLTLIYGDHSKEMGLIAALHKKAAENSANDNQKKMQLAYAKSFEEGSLEAYKDSQRYWI
RDKGPMVESNIGFVETYRDPHGVRGEWEGFAATVNLERTRAFGSLVDAAEAMIPKLPWSA
EFEKDKFLSPDFTSLEVLSFAGSGIPAGINIPNYDDIRQSEGFKNVSLGNVLSAKAPNEK
IPFISEADLPIYQKYSDAAFEVQVGIHELLGHGTGKLLQETEPGKFNFDPKNPPISPITN
RPVTTYYKPGQTWGSVFGSVASSYEECRAECVAMALSCDFEILKIFGFGDGTPNMDGDAG
DVLYASYLSMARAGVASLEMWDPASRKWGQAHSQARYSILKCFLAAPDNFCKLDYKNEDL
SDLTIKIDRSKITTVGRKAVESYLQKLHIYKSVADKEAGTNLYAEMTEVEPEFWGKTIRN
EVLRNKQPRKVFVQANTVLDEATGKVSLVEYEPSLEGMVKSYADREV
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgactgaaattaagaacttcctggcagactcgcccccgagcactgtcaagctc
gagattaaaaagcatttcgatgctctgactgaccaacaggctcgctatgcgcactttatc
agcagggctgccttcaccgggactcgtatcaccctccgccaggtctccccggaatctgag
agcatctttgacttcattgtcgagctatacaaggcctcgaatggtgactggaaagccctt
caagagaaggctggaatttctgctgaagagcttcagcaattcctcgagtacgctgctcaa
ttcctaggcaattgcggtaactacaaggggttcggagacgtcaaatttgtaccaagatgt
agtgagaaggcattcgataacttagctgctgcggcacccaaagctggggtgcactacaag
gcgacaaagggtgctatattctctagcaataaggaggggattatgcatctaggatacctt
gatgaaggccacatgactacgtattatccagactcgaaaggaatcacaaaagcggacatt
gctgcggtttcagactacatggagaagataggacttctggtggaaaacactcgcctcaga
aagaagacagacggaaactttgacttgttgatagcatcagcagtaacccaagttcctgaa
gcaggtggagatgtcggcaagaacacagagtttgagatcgacagcggatctctgaagggc
aagaagttgacgctgatatatggtgaccactcaaaggagatggggctaattgccgcactt
cacaagaaggcggcagagaattctgccaacgataatcagaaaaagatgcaactcgcttat
gccaagtcgttcgaggaaggatcgcttgaagcttataaggactcccaaagatactggatc
agagacaagggcccgatggtcgaatctaacatcggcttcgttgagacctatcgagatcct
catggtgtacgtggagagtgggaaggttttgccgctaccgtcaacttggagcgtacaaga
gcattcggctccctagtcgatgccgctgaagcaatgatccccaagcttccatggtcggcg
gaattcgaaaaggacaagttcctgagccccgatttcactagtttggaagtattgtcattt
gctggctcaggcatccctgcgggcatcaatattccaaactacgacgatatcagacaatca
gagggattcaaaaacgtcagcttgggtaatgttctcagcgccaaggcccccaatgagaag
attccattcatctctgaggccgatctcccaatctatcaaaagtacagtgatgcagctttc
gaggtgcaggttggcatccatgaacttcttggccacggcaccggtaagcttctgcaagag
accgaaccaggaaagttcaactttgatccaaaaaaccctcctatcagccctataacgaac
aggcccgtcaccacttattacaagcctggccagacctggggctcagtattcggtagtgtt
gcttcaagttacgaagagtgcagagccgagtgtgttgccatggcgttgagctgtgacttt
gagattctgaaaatctttggcttcggagatggaacgcctaatatggacggcgacgctgga
gatgtgctttatgcatcctacctgtctatggcacgcgccggagttgcctcccttgagatg
tgggaccctgcctctagaaaatggggacaagcccattctcaagcccgctacagcattctg
aagtgtttccttgctgctccagataacttctgcaagctggactacaagaatgaggacctc
tctgatcttacaatcaagattgaccgaagtaagataacaactgttggacggaaggctgtc
gagtcgtacctccaaaagctccacatctacaagtcggttgctgataaagaggctggtacc
aacctctatgctgagatgaccgaggtggagcctgagttctggggcaagactatcagaaat
gaagttctgagaaacaagcagccaagaaaggtgttcgttcaagccaacacggttttagat
gaggcgacgggaaaggtttcgttggtggaatatgagcctagtctcgagggtatggtgaag
agctacgccgatagagaggtttga

DBGET integrated database retrieval system