KEGG   Marssonina brunnea: MBM_06276Help
Entry
MBM_06276         CDS       T03105                                 

Definition
(RefSeq) aromatic-L-amino-acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
mbe  Marssonina brunnea
Pathway
mbe00350  Tyrosine metabolism
mbe00360  Phenylalanine metabolism
mbe00380  Tryptophan metabolism
mbe01100  Metabolic pathways
mbe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mbe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    MBM_06276
   00360 Phenylalanine metabolism
    MBM_06276
   00380 Tryptophan metabolism
    MBM_06276
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    MBM_06276
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mbe04147]
    MBM_06276
Enzymes [BR:mbe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     MBM_06276
    4.1.1.105  L-tryptophan decarboxylase
     MBM_06276
Exosome [BR:mbe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MBM_06276
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 18762211
NCBI-ProteinID: XP_007294165
UniProt: K1X4T2
Position
Unknown
AA seq 529 aa AA seqDB search
MDSKQFKEAATSAIDEIVNYYETIEDRRVVSNVEPGYLKKLLPDGPPQDGESWGDIQKDI
ESKIVPGLTHWQSPNFMAFFPASSSFPGMLGELYSAAFTAPAFNWICSPAVTELETIVLD
WLAKLLNLPDCYLSTSHGGGVIQGSASEAIVTSMVAARDKYLRETTSHLSGAELEDAIAY
KRSKIVALGSEAAHSSTQKAAQIAGVRYRSIPVSKDTNFALTGAGLEEMLKQCKAQGLEP
FYLTTTLGTTATCAVDDFGSIAATLAKYAPPNVTGEIWVHVDAAYAGAALVCPEYQHLTA
SLEHFHSFDMNMHKWLLTNFDASCLFVRKRKDLIDALSIMPSYLRNEFSESGLVTDYRDW
QIPLGRRFRSLKIWFVMRTYGVNGLQAHIRKHVKLGEMFADLLRTREDLFKIVTGPTFAL
TVFTIVPKIAGKEEQDAITKAVYELINKRGEIYITSSVVAGEYVIRVVSANPMAEEKFLK
KAFDILVDTAEELRDGRPSRRGVNGAIVNGKGEGVGEVAVLNGNGAAAV
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggactcaaagcagttcaaggaagctgctacatcagcaatcgacgagatcgtcaactac
tacgagacgattgaggaccgcagagtagtctctaacgtcgaacccgggtacctcaagaag
ctcctcccagatggaccgccacaggatggagagtcatggggagatattcagaaggatatc
gagagtaagatcgtaccaggactcacccactggcaatcccccaatttcatggccttcttc
cccgcgtcctcttctttccccggtatgctcggcgagctctactcggcagcattcacagct
ccagcattcaactggatctgctctcccgcagtcaccgagctcgaaaccatagtcctggac
tggcttgcaaagctcctgaatctgccagactgctacctctcgacaagccacggaggaggg
gtaatccagggctcggcgtctgaagctattgttacatcaatggttgctgctcgggacaaa
tacttgcgtgaaacaacgtcacacctgtcaggagcggaactggaggatgcgatcgcatac
aagaggagcaagattgtagccctgggcagtgaagcggcacatagctccacacagaaggcg
gcgcaaatagcgggggtcagataccgctcaatacccgtttcgaaagacaccaactttgct
cttaccggtgctggactagaagaaatgctgaaacagtgcaaggctcagggattggagcca
ttctacctcaccactaccttggggacgactgctacatgcgccgtcgatgattttgggtca
atagcggcaactttggcgaaatatgctcctccgaacgtcactggcgaaatctgggtacat
gttgatgctgcatatgctggtgcggctcttgtatgcccagagtaccagcatctcactgct
tcactcgagcatttccactcctttgacatgaacatgcacaagtggctcctcacaaacttc
gacgcctcgtgtttgtttgtgagaaaacgcaaagatctgattgatgctctatccatcatg
ccaagctatctacgcaatgagttctcagaaagcggtcttgtcacggattaccgagactgg
cagatcccgctcgggagacgattcagatcattgaagatttggtttgtaatgcgaacctat
ggtgtcaatggactgcaggctcatatcaggaagcacgtcaagcttggcgagatgttcgcc
gacctgctgaggacgagggaggacctcttcaagattgtcaccggaccgactttcgcgctt
actgtcttcactattgtaccgaaaatcgcgggcaaagaggagcaagatgcgattacgaag
gcggtgtatgaattgatcaataaacggggcgagatatatatcacttcaagtgttgtggct
ggcgagtatgtgattagggtggtcagtgccaacccaatggcggaggagaagttcttgaaa
aaggcgtttgatatcctggtggatactgctgaggagctgcgggatgggaggccgagtagg
aggggggtaaacggcgctattgtgaatggcaaaggcgaaggcgttggagaggttgccgtt
ttgaatgggaatggagctgctgcggtatag

DBGET integrated database retrieval system