KEGG   Marssonina brunnea: MBM_08711Help
Entry
MBM_08711         CDS       T03105                                 

Definition
(RefSeq) alcohol dehydrogenase, zinc-containing
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
mbe  Marssonina brunnea
Pathway
mbe00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:mbe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MBM_08711
Enzymes [BR:mbe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     MBM_08711
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     MBM_08711
    1.1.1.-  
     MBM_08711
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 FAD_binding_3 TrkA_N XdhC_C AdoHcyase_NAD F420_oxidored FAD_binding_2 Shikimate_DH
Motif
Other DBs
NCBI-GeneID: 18764646
NCBI-ProteinID: XP_007296600
UniProt: K1WX57
Position
Unknown
AA seq 385 aa AA seqDB search
MAANIRALRFYGRGDIKLESVQAAPCGSDEVRVKIAYCGICGTDIHEYLGGPIFPPQPGQ
KNPHSGAELPVTLGHEMSGTILEVGAGVTAALHVGQRICVNPSMDDRHHGRAACAACRAG
RPNLCARWTCYGLSARGGGLAGEIVVKAVSCLGLPPGVSLPVGALVEPLAVAAHMLRLAG
FAAGQDVVVLGAGPVGLALLLLLRARGARTVVVSEVAAARARQAARFGADVVVNPLRRAA
AGAEAEPAADADAVREAVAREMGEGGADIAFDATGLQSTLDTALAVVKPGGVVFNVAIHE
KPLLVNPNAFTFKEARLMGGICYTREDFEEVLRALAAGELPDAADLITSIVPLEDVVEGA
FLELIHNKTEHVKILVRPSQDPDLA
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaatatccgagctctccggttctacggaagaggagacatcaagctggaatcg
gtccaggcagctccatgcgggagcgatgaggtccgcgtgaagatcgcgtactgcggcatc
tgcggcaccgacatccacgagtacctgggcgggcccatcttcccgccccagcccgggcag
aagaacccccacagcggcgccgaactccccgtgaccctcggccacgagatgtcgggcacc
atcctcgaggtcggggccggcgtgacggcggccctccacgtcggccagcggatctgcgtc
aacccgtccatggacgaccggcaccacggccgggccgcctgcgccgcgtgccgcgcgggc
cggccgaacctctgcgcgcgctggacgtgctacgggctcagcgcccgcggcggcggcctc
gcgggggagatcgtcgtcaaggccgtcagctgcctgggcctgccgccgggcgtctcgctg
ccggtcggggcgctggtcgagcccctagccgtggcggcgcacatgctgcgcctcgcgggc
ttcgcggccggccaggacgtggtggtgctgggggcgggccccgtggggctggcgctgctg
ctgctcctgcgggcgcgcggcgcgcgcacggtggtcgtcagcgaggtggcggcggcgcgg
gcgcggcaggcggcgcggttcggcgcggacgtcgtggtgaaccccctccgccgtgctgcg
gccggggccgaggcggagccggctgcggatgcggatgcggtgcgggaggctgtcgcgcgg
gagatgggggagggcggggcggacatcgcgttcgatgcgacgggcttgcaatccacgctg
gacacggcgctggcggtggtgaagccgggcggggtggtcttcaacgtggcgatccacgag
aagccgctgctcgtcaaccccaacgcgttcaccttcaaggaggcgaggctcatgggcggc
atctgttacacgcgcgaggatttcgaagaggtgttgcgcgcgctggcggcgggggagctg
ccggacgcggcggacctgatcacttcgatcgtgccgctggaggacgtggtggagggcgcc
ttcttggagcttatccataacaagacggaacatgtcaagatcctcgtcagaccttcgcag
gatccggatctcgcttag

DBGET integrated database retrieval system