KEGG   Marssonina brunnea: MBM_08938Help
Entry
MBM_08938         CDS       T03105                                 

Definition
(RefSeq) aminotransferase class 3
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
mbe  Marssonina brunnea
Pathway
mbe00860  Porphyrin and chlorophyll metabolism
mbe01100  Metabolic pathways
mbe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mbe00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MBM_08938
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mbe01007]
    MBM_08938
Enzymes [BR:mbe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     MBM_08938
Amino acid related enzymes [BR:mbe01007]
 Aminotransferase (transaminase)
  Class III
   MBM_08938
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-GeneID: 18764873
NCBI-ProteinID: XP_007296827
UniProt: K1XJX4
Position
Unknown
AA seq 371 aa AA seqDB search
MSHVAWVEPCLFRTTITKRFSPSGVELVRFTNSGTEASTMAVAAALAFTNRKKILVFTSG
YHGGTMSFPSPLNSINANLPHEFVLAPYNDVEGTKRVLSSLPKDSLAAIVVEGVHGSGGC
IVGNPFFLHFLNATARELGAVLIMDEVMTSRLAYHGLSAKLALKPDLITLGKWVGGGMTF
GAFGGRKDIMSMFDPRTGVLGHSGTFNNNVITMAAGCCGLDIYDEHEVERLNAMGEDLLQ
RIQIVLVEAGVRAFKADSKADPISSQRSELECPFSGILPAGFGSEKTAESLRRRQKNSMG
VTGQGSMLHIHFYGPSTITLKALFWHHMLDCGIYIAQRGFMALNLELTNRNVDEFEEAVR
AFLIRYGDALR
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgtcacatgtagcttgggtggaaccatgcctgttccgcacaacaataaccaagcgcttc
tccccgtccggcgttgagctcgtccgcttcacaaactccggcacagaagccagcaccatg
gccgtagcagccgctctggccttcacgaaccgtaagaaaatcctcgtcttcaccagcggc
taccatggaggaaccatgtccttcccatcgccgctcaactccatcaacgccaatcttccc
cacgagttcgttctcgcgccttacaatgatgtagaaggcaccaaacgtgttctatcatca
cttcccaaggattcgcttgctgccatcgttgtggagggtgtccatggaagcgggggctgc
atcgtagggaaccctttcttcctccactttctgaatgcaacagcgcgcgagctcggcgca
gtgctcatcatggatgaagtcatgacatcgcggctcgcctatcacggtctctctgccaaa
ctagcactcaagccagacctaatcactctcggaaagtgggtgggaggcggcatgaccttc
ggcgctttcgggggcaggaaagacataatgagtatgtttgatcctcgaacgggcgtcttg
ggccactcggggactttcaacaataatgtgatcacgatggctgccggatgctgcgggctg
gatatctacgacgagcatgaagtcgagcgactgaatgccatgggcgaagatctgctccag
cgcatccaaatagttttggtagaagctggcgttcgcgccttcaaggccgactcaaaggca
gatcctatatcgtctcaaaggagcgaactcgaatgtccctttagcgggattctacccgct
ggctttggaagcgagaagactgctgagtctctacgtcggcggcagaagaactccatggga
gtgacgggacaagggagtatgctgcacatacacttctatgggccgagcaccattactctg
aaagcgctgttctggcaccacatgctggactgtgggatatacatcgcccagagagggttc
atggcactaaatctggagctgactaataggaatgttgatgaattcgaggaggcggttagg
gcatttcttattaggtacggggatgcactgcgatga

DBGET integrated database retrieval system