KEGG   Marssonina brunnea: MBM_09470Help
Entry
MBM_09470         CDS       T03105                                 

Definition
(RefSeq) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
mbe  Marssonina brunnea
Pathway
mbe00220  Arginine biosynthesis
mbe00330  Arginine and proline metabolism
mbe01100  Metabolic pathways
mbe01110  Biosynthesis of secondary metabolites
mbe01130  Biosynthesis of antibiotics
mbe01230  Biosynthesis of amino acids
Module
mbe_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:mbe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    MBM_09470
   00330 Arginine and proline metabolism
    MBM_09470
Enzymes [BR:mbe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     MBM_09470
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 18765405
NCBI-ProteinID: XP_007297359
UniProt: K1WHT7
Position
Unknown
AA seq 328 aa AA seqDB search
MTTTSMIQPKFLSKGDQLGVVAVGFSGGQCKPGVDAAPSALIESGLLTQLKEELGYKLFH
DDTVHSYKDLLPASDPDYRGMKNPLAVSAVTRKLSEQVYSHAKEGRMVLTLGGDHSIAIG
TIAGTAKAIRERLNREMAVVWVDAHTDINTPETSDSGNVHGMPVAFLTGLATDEREDVFG
WLRKENMISVKKLVYIGLRDVDRGEKLILRENGIKAFSMHDIDRHGIGKVMEMALAHIGN
DTPIHLSFDVDALDPMWAPSTGTPVRGGLTLREGDFIAECVHETGCLVAMDLVEVNPTLE
PGVDDIGAHMTVRSGCSLVRCALGESLL
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccacctcgatgattcaaccaaagttcctttcgaaaggtgaccagctcggcgtg
gtcgccgtcggtttctctgggggacaatgcaaacctggagtcgacgccgcgccctcggct
ctgattgagagtggccttttgacccagctcaaggaagaactgggctacaaactctttcac
gatgatactgtccactcctacaaggacctgctccctgcctccgatccggactaccgcgga
atgaagaacccactcgcagtatctgctgttactcgcaagctttcggaacaagtgtattcc
catgcgaaggaaggccgaatggttcttacactcggaggtgaccacagtattgccattggc
acaattgcgggaactgcaaaggctattcgagaacgcttgaatcgcgagatggccgtagtc
tgggtagatgcgcatacggatatcaatactccagagacaagtgatagcggaaacgttcac
gggatgccggttgcgttcttgactggccttgccacagacgagcgggaggacgtctttgga
tggttgaggaaggaaaacatgatcagcgtcaagaagttggtttacattggtctacgcgat
gttgaccggggcgagaagcttattttgagagagaatggcatcaaagcattcagcatgcat
gacatcgacagacacggcatcggcaaagtcatggaaatggccttagctcatattggcaat
gacacacccatccatttgtctttcgatgtcgatgcactggacccaatgtgggctcctagc
accgggacacccgttcgcggaggactcactttgagagaaggggactttatcgccgagtgc
gttcacgagaccggttgcttggttgccatggatctggtcgaggtcaaccctacgctggag
ccaggtgttgacgatattggagcccatatgaccgtcagatctggctgttcgctggtcaga
tgcgcattgggcgagtctcttctgtaa

DBGET integrated database retrieval system