KEGG   Candidatus Melainabacteria bacterium MEL.A1: BHV42_03920Help
Entry
BHV42_03920       CDS       T04546                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
mbf  Candidatus Melainabacteria bacterium MEL.A1
Pathway
mbf03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mbf00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BHV42_03920
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mbf03011]
    BHV42_03920
Ribosome [BR:mbf03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BHV42_03920
  Bacteria
    BHV42_03920
  Archaea
    BHV42_03920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AOR38397
UniProt: A0A1D7YS68
Position
complement(821706..822044)
Genome map
AA seq 112 aa AA seqDB search
MEAKARQTDIKMTARKLRRVINEVRGKSVVEAQDMLRFMPYFAARVVEKNLKAAVANAQE
KYGVGAESLKVSEIFADESVTYKRARTRAQGRMYSRLKRTSHLTLKVSDITK
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atggaagctaaagcaagacaaactgatataaaaatgacagcaagaaaacttcgtagagta
atcaacgaagttagaggtaaatctgtcgttgaagctcaagatatgttacgttttatgcct
tattttgcagcaagagtagttgaaaagaacttgaaagctgcagttgcaaatgcacaagaa
aaatatggtgtaggagctgaatctttgaaagtttctgaaattttcgcagatgaaagcgtt
acatacaaaagagcaagaacaagagcgcaaggtcgtatgtattcaagactaaaacgcact
tctcacttaactttaaaagtaagtgatatcactaagtag

DBGET integrated database retrieval system