KEGG   Methanoculleus bourgensis: BN140_0034Help
Entry
BN140_0034        CDS       T02189                                 

Definition
(GenBank) acetate-CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mbg  Methanoculleus bourgensis
Pathway
mbg00010  Glycolysis / Gluconeogenesis
mbg00620  Pyruvate metabolism
mbg00640  Propanoate metabolism
mbg00680  Methane metabolism
mbg00720  Carbon fixation pathways in prokaryotes
mbg01100  Metabolic pathways
mbg01110  Biosynthesis of secondary metabolites
mbg01120  Microbial metabolism in diverse environments
mbg01130  Biosynthesis of antibiotics
mbg01200  Carbon metabolism
Module
mbg_M00357  Methanogenesis, acetate => methane
mbg_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mbg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN140_0034
   00620 Pyruvate metabolism
    BN140_0034
   00640 Propanoate metabolism
    BN140_0034
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    BN140_0034
   00680 Methane metabolism
    BN140_0034
Enzymes [BR:mbg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BN140_0034
Lipid biosynthesis proteins [BR:mbg01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BN140_0034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-GeneID: 13355327
NCBI-ProteinID: CCJ34957
UniProt: I7LIG8
Position
complement(29697..31586)
Genome map
AA seq 629 aa AA seqDB search
MTGTFAVKLEEKRYLPDPRFKATAWTPDYTRAYQEFMRDPDAFWDRIARELVWFGPWDRV
REWNHPYAKWFVNGKMNITYNCLDRHVTSERKDKPALVWRGEGGEERRLTYDGLYREVMR
FANGLKSLGVGKGDRVCIYMPLVPEQVVAMLACARIGAVHSVVFGGFGPDALAMRINDAE
AKVLITADVGYRRGKAVPLREIAKEALTHTPCVEKVVVLRRGTPAVDLDPAREVDYADLC
REAAPDCPAETMDAEDPLFILYTSGSTGAPKGIVHSCGGYAVGTYYTARHDFDIKETDVF
WCTADPGWITGHSYVVYGPLAVGTTVVIVEGTPDYPDPGVYWHLVQDLGVTIFYTAPTAI
RMFMRYGDEWPAKYDLSTLRVLGSVGEPLNPEAFEWYYHHIGGGRCPVVDTWWQTETGMH
IITTMIGEAMKPGFAGKPIPGAVVDVVDRQGNPVPPGTGGFLVIREPWPAMLRTVYRNDE
RYRTYWETIPGCYTAGDLAVKDKEGYIMILGRADDLIIVAGHNIGTAEVESALVSHDAVA
EAAVIGKPDPLKGNVIKAFVTLRVGVSPGDGLSAELARHVRKSLGPVAVPAEIEYVDRLP
KTRSGKIMRRVLKARELGIDPGDISTLEE
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgacagggacgtttgctgtgaaactggaagagaagcgttaccttcccgatccgcggttc
aaggcgaccgcctggacgcccgattacacccgggcctaccaggagttcatgcgcgacccg
gacgccttctgggaccggatcgcccgcgaactggtctggttcgggccctgggaccgggtc
agggaatggaaccacccctacgcgaaatggttcgtcaacggaaagatgaacatcacctac
aactgcctggaccgccacgtcaccagcgagcggaaggataagccggcgctcgtctggcgc
ggggaaggaggggaggagcggaggctcacctacgacggcctctaccgcgaggtgatgcgg
ttcgcaaacggcctcaaaagcctcggcgtcgggaagggtgaccgggtctgcatctacatg
ccgctcgtccccgagcaggtcgtcgcgatgctcgcctgcgcccggatcggggccgtccac
tcggtggtcttcggggggttcgggccggacgcgcttgcgatgcggatcaacgatgcggag
gcaaaggtcctcatcaccgctgacgtcggctaccggcgggggaaggccgtcccgctccgg
gagatcgcaaaggaggcgctcacccacaccccctgcgtcgagaaggtcgtcgtgctgcgg
cgcgggactccggccgtcgacctcgaccccgcccgggaggtcgattacgccgacctctgc
cgcgaggcagcaccggactgcccggcagagacgatggacgcggaggatcccctcttcatc
ctctacaccagcggctcgaccggcgcgccgaaaggcatcgttcattcctgcggcggctac
gcggtcgggacctactacaccgcccgccacgacttcgatatcaaggagaccgacgtcttc
tggtgcaccgccgaccccggctggatcaccggccacagttacgtcgtctacggcccgctc
gcggtcgggacgacagtcgtcatcgtcgagggaacccccgactaccctgacccgggcgtc
tactggcatctggtccaggacctcggggtgacgatcttctacaccgccccgaccgcgatc
cggatgttcatgcgctacggtgatgagtggccggcgaagtacgacctctcaacgctccgg
gtgctcgggtcggtcggtgaacccctcaaccctgaggcgttcgagtggtactaccaccat
atcggcggcgggcgatgcccggtcgtggatacctggtggcagaccgagaccgggatgcac
atcatcaccacgatgatcggcgaggcgatgaagccggggtttgccggaaaacccatacca
ggcgccgtcgtggacgtcgtcgaccgccagggcaacccggtcccccccggcaccggcggg
ttcctggtcatcagggaaccctggcccgccatgctcaggacggtctaccggaacgatgag
cgctaccgcacctactgggagaccatcccggggtgctacacggccggagacctcgcggtg
aaggataaggagggctacatcatgatcctcgggcgggccgacgacctgatcatcgtcgcc
gggcacaacatcggcaccgccgaggtcgagagcgcgctcgtctcccacgatgcggtggct
gaggcggccgtcatcgggaagcccgatcccctgaaagggaacgtcatcaaggccttcgtc
accctccgcgtgggggtgagccccggcgacgggctctccgccgaactcgcccgccatgtc
aggaaaagcctcgggcccgtcgcggtgccggccgagatcgagtacgtggaccggctcccg
aagaccaggagcggcaagatcatgcgccgggttctgaaagcccgtgagctcggcatcgat
ccgggggatatctccaccctggaggagtga

DBGET integrated database retrieval system