KEGG   Methanoculleus bourgensis: BN140_0892Help
Entry
BN140_0892        CDS       T02189                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mbg  Methanoculleus bourgensis
Pathway
mbg00020  Citrate cycle (TCA cycle)
mbg00640  Propanoate metabolism
mbg00660  C5-Branched dibasic acid metabolism
mbg00720  Carbon fixation pathways in prokaryotes
mbg01100  Metabolic pathways
mbg01110  Biosynthesis of secondary metabolites
mbg01120  Microbial metabolism in diverse environments
mbg01130  Biosynthesis of antibiotics
mbg01200  Carbon metabolism
Module
mbg_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mbg00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BN140_0892 (sucC)
   00640 Propanoate metabolism
    BN140_0892 (sucC)
   00660 C5-Branched dibasic acid metabolism
    BN140_0892 (sucC)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    BN140_0892 (sucC)
Enzymes [BR:mbg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BN140_0892 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-GeneID: 13355368
NCBI-ProteinID: CCJ35815
UniProt: I7KYM7
Position
complement(935136..936221)
Genome map
AA seq 361 aa AA seqDB search
MKLLEYEAKEIFSKYGIPVPKGVLIRAPEEVTAHLPRIGDAVVLKAQVDVGGRGKAGGVL
MAEDATAVETARELFSREIKGVPVRSILVEERLAIEHEYYVSIAVDRSSRQPVVLFADAG
GVEIENAAMADESAVRRVVVSPLLRDIPPFLMRELLGGAPKELAPTINSLYHAFQEKDAM
LAEINPLVTTPQGVYAADAKLIIDDNALARQGIAVNRDLSEREREAEKHGFSYVELDGSI
GVIGNGAGLTMSTLDLIEYYRGQAANFLDVGGGADQERVMHAVRLVASMPGVNVIVVNLL
GGITRCDEVAKGIIAAGVAPTVIVRMAGTNEEEGRQLLAEHGYRMLESMDAAVRAAMEVA
A
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaaactactggaatacgaggcaaaagagatcttttcgaagtacggcattccggtcccg
aaaggggttctgatacgggcaccggaagaggtcacggcacacctgcccaggatcggcgat
gccgtggtgctgaaggcgcaggtggacgtcggcggacgggggaaggcaggcggcgtcctg
atggcagaggacgcgacggcggtcgagaccgcccgggaactcttctcccgggagatcaag
ggtgtcccggtcaggagcatcctcgtcgaggagaggctcgcaatcgagcacgagtactac
gtcagcatcgccgtcgaccggtcgagcagacagccggtggtcctcttcgccgacgcaggc
ggggtggagatcgagaacgcggcgatggccgacgagtcagccgtccgcagggtcgtcgtg
tcgccgcttctccgggacatcccgccgtttctcatgcgggaactcctcggcggagcccca
aaagaacttgcacccacaataaacagtctctaccacgcgttccaggagaaggacgctatg
cttgcggagatcaacccgctcgtgacgacgccgcagggagtctacgcggccgacgcaaaa
ctcatcatcgacgacaacgccctcgcccggcaggggatagcggtcaaccgcgacctctcg
gaacgcgagcgtgaggccgagaagcacggcttctcctacgtggaactggacggaagcatc
ggtgtcataggaaacggcgccgggctcacgatgtcgacgctcgacctcatcgagtactat
cggggacaggcagcaaacttcctcgatgtcggcggcggcgccgaccaggagcgcgtgatg
cacgcagtcaggctcgtcgcgagcatgcccggggtgaacgtgatcgtggtcaacctcctc
gggggcatcacccggtgcgacgaggtggcgaagggaatcatcgccgccggcgtcgcaccg
acggtcattgtccggatggccgggacgaacgaggaggaaggacggcaactgctcgccgag
cacggctaccggatgctcgagagcatggatgcggctgtccgggcggcgatggaggttgca
gcatga

DBGET integrated database retrieval system