KEGG   Methanoculleus bourgensis: BN140_1334Help
Entry
BN140_1334        CDS       T02189                                 

Gene name
porC
Definition
(GenBank) pyruvate ferredoxin oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
mbg  Methanoculleus bourgensis
Pathway
mbg00010  Glycolysis / Gluconeogenesis
mbg00020  Citrate cycle (TCA cycle)
mbg00620  Pyruvate metabolism
mbg00633  Nitrotoluene degradation
mbg00640  Propanoate metabolism
mbg00650  Butanoate metabolism
mbg00680  Methane metabolism
mbg00720  Carbon fixation pathways in prokaryotes
mbg01100  Metabolic pathways
mbg01120  Microbial metabolism in diverse environments
mbg01130  Biosynthesis of antibiotics
mbg01200  Carbon metabolism
Module
mbg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mbg_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mbg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN140_1334 (porC)
   00020 Citrate cycle (TCA cycle)
    BN140_1334 (porC)
   00620 Pyruvate metabolism
    BN140_1334 (porC)
   00640 Propanoate metabolism
    BN140_1334 (porC)
   00650 Butanoate metabolism
    BN140_1334 (porC)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    BN140_1334 (porC)
   00680 Methane metabolism
    BN140_1334 (porC)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    BN140_1334 (porC)
Enzymes [BR:mbg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     BN140_1334 (porC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR DUF2178
Motif
Other DBs
NCBI-GeneID: 13355441
NCBI-ProteinID: CCJ36257
UniProt: I7LJR1
Position
1373116..1373643
Genome map
AA seq 175 aa AA seqDB search
MYEIRIHSRGGQGGVTAARLLALAAFRDGKYATACPFYGAERRGAPVVSFVRIDDKPIKI
YSQIHEPDLVIVLDASIMDVVDVLQGLKEDGTVLLNSAHALEGCGATCRHVDLTGIALAK
NLVIAGSPILNTPVLGALAKMGVVTLPSVEKAIREMFADERNVQAAEAAYEELKI
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgtatgagatcaggatccactcccggggcgggcagggcggtgtcaccgccgcccgcctg
cttgccctcgcggcgttccgggacggaaaatacgcaactgcctgtccgttctacggggcg
gaacggcgcggggcgccggtcgtctcgtttgtcaggatagacgataagccgatcaagatc
tacagccagatccacgaaccagatctcgtgatcgtgctcgatgcgagcatcatggacgtc
gtggacgtcctgcagggtctcaaagaggacgggacggtactcttaaacagcgctcacgcg
cttgaggggtgcggcgcgacctgccgccacgtcgacctgaccgggattgcgctcgccaag
aacctggtgatcgccgggagtcccatcctcaacaccccggtgctcggggcgcttgcgaag
atgggcgtcgtcacgctcccgtcggtcgagaaggcgatccgggagatgtttgccgatgag
cggaacgtacaagctgctgaagcggcatatgaggagctgaagatatga

DBGET integrated database retrieval system