KEGG   Methanoculleus bourgensis: BN140_1512Help
Entry
BN140_1512        CDS       T02189                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mbg  Methanoculleus bourgensis
Pathway
mbg00260  Glycine, serine and threonine metabolism
mbg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mbg01100  Metabolic pathways
mbg01110  Biosynthesis of secondary metabolites
mbg01130  Biosynthesis of antibiotics
mbg01230  Biosynthesis of amino acids
Module
mbg_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mbg00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BN140_1512 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BN140_1512 (trpA)
Enzymes [BR:mbg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BN140_1512 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth ThiG
Motif
Other DBs
NCBI-GeneID: 13355410
NCBI-ProteinID: CCJ36435
UniProt: I7KZR9
Position
1538780..1539568
Genome map
AA seq 262 aa AA seqDB search
MSRLSAAFAGRNGPTFVGFLVAGDPDPATSLTVAKAMIDAGAGILEVAVPFSDPMADGPV
IQQAHERALAAGMTPDATFDLVRAIRGYAPVPVVLFTYANIVFRQGWDRFAVRAAGAGAD
GLLVVDLPPEESGDLSAAAARHGLDLIRLIAPTTSAARRRQILAGASGFVYLVAVEGVTG
VRDNLPAHLAGLIGTLRQETDLPLAVGFGVSRPGHVRAIATAGADAVVVGSAVVRVIGES
PGGGEEMVQAVRDYVAGMTGRP
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgagcaggctctccgccgcattcgcgggccggaacggtccgacattcgtcgggttcctg
gtcgccggagaccctgacccggcaacgtcgcttaccgtcgcgaaggcgatgatcgatgcc
ggggccggtatcctcgaggtcgccgtccccttctctgaccccatggccgacggcccggtc
atccagcaggcccacgagcgggcgctcgccgccgggatgaccccggatgcgacgttcgac
ctggtgcgggcgatccggggttacgccccggtgccggtcgtcctctttacgtatgcaaac
atcgtcttccggcaggggtgggaccggttcgccgtccgggccgcgggggcgggggccgac
ggccttctggtcgtcgacctcccgcccgaagagtccggggacctctcggcagccgcggcc
cggcatggtcttgacctcatcaggctcatcgccccgacgacatcggcggcccgccggcgg
cagatcctcgccggtgcgtcggggttcgtctacctggtcgcggtcgagggggtgaccggt
gtccgggacaacctcccggcgcaccttgcaggcctgatcgggacactcaggcaggagaca
gacctcccgcttgccgtcgggttcggggtctcccggcccgggcacgtccgggcgatagcg
accgccggtgcggacgcggtcgtcgtcgggagcgccgttgtccgggtcatcggggagagc
cccggcggcggggaggagatggtgcaggcggtccgggactacgttgccgggatgacgggg
cggccatga

DBGET integrated database retrieval system