KEGG   Methanoculleus bourgensis: BN140_1524Help
Entry
BN140_1524        CDS       T02189                                 

Gene name
mcrB1
Definition
(GenBank) methyl-coenzyme M reductase beta subunit
  KO
K00401  methyl-coenzyme M reductase beta subunit [EC:2.8.4.1]
Organism
mbg  Methanoculleus bourgensis
Pathway
mbg00680  Methane metabolism
mbg01100  Metabolic pathways
mbg01120  Microbial metabolism in diverse environments
mbg01200  Carbon metabolism
Module
mbg_M00357  Methanogenesis, acetate => methane
mbg_M00567  Methanogenesis, CO2 => methane
mbg_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mbg00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    BN140_1524 (mcrB1)
Enzymes [BR:mbg01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.4  Transferring alkylthio groups
    2.8.4.1  coenzyme-B sulfoethylthiotransferase
     BN140_1524 (mcrB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCR_beta MCR_beta_N
Motif
Other DBs
NCBI-GeneID: 13355124
NCBI-ProteinID: CCJ36447
UniProt: I7LJY5
Position
complement(1549890..1551194)
Genome map
AA seq 434 aa AA seqDB search
MAKYSETIDLYSDDGKLLKSGVSLDRISPLVNPATSKIIDLTKRTINVNLGGIQDALKNG
KLGQGKIKGRELDLPIMENKDAIVAKIKEMIQVEEGDDTEILEFNGGKLQLVQVPAKRLI
NAATYDAAITAVASATTYAIVDQFNVDAFNASTVKAACWGGYPHTQDMKGSLVTSILNIP
QNNEGLGYALRNIPVNHVVMMTNRNALQGAALSSTLETAGIFEMGSAIGPFERATLLAYA
YQGLNANNMVYDLVKANGQTGTVGTVVQSLVERAIEDKVITPGKKGGYFQFYDTKDPMLW
NAYTAAGSMAATIVNCGAGRFAQAVSSTLLYFNDLLEHETGLPSSDYGRVMGTAVGFSFF
SHSIYGGGGPGIFNGNHVVTRHANGVAIPCVVAAAALDAGTQMFSPENTSKIFADTYGKI
DVFNKPINQIANGA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggctaaatactcggaaacaatcgatctctattctgatgatgggaagctgctcaagagc
ggcgtctccctcgacagaatcagcccgctggttaacccggccacaagtaagatcatcgac
ctgaccaagagaacaatcaacgtaaaccttgggggcatccaggatgcgctcaagaacgga
aaacttggacagggcaagatcaagggaagagaactggatctccccatcatggagaacaag
gacgccatcgtcgccaagatcaaggagatgatccaggttgaagaaggtgatgacaccgag
atcctggagttcaacggaggaaagctccagcttgtccaggtcccggcgaagcgcctgatc
aacgcggccacctacgatgcagcaatcaccgcggtcgcctccgcgaccacctacgcgatc
gtcgaccagttcaatgtcgacgctttcaacgcttccaccgtcaaggcggcctgctggggc
ggttacccgcacacccaggacatgaagggctcgctcgttacgtcgatcctgaacatcccc
cagaacaacgaaggtctcggctacgcgctccggaacatcccggtcaaccacgtcgtgatg
atgaccaacaggaacgccctgcagggcgctgcactctcatccacgctcgagaccgccggt
atcttcgagatgggatccgccatcggacccttcgagcgtgccacgctgctcgcctacgcc
taccagggcctgaacgcgaacaacatggtctacgacctcgtcaaggcaaacggccagact
ggaaccgttggtacggttgtccagagcctggtcgagcgtgctatcgaggacaaggtcatc
acccccggcaagaagggcggatacttccagttctacgacacgaaggaccccatgctctgg
aacgcctacactgctgcgggatccatggcagccaccatcgtcaactgtggtgccggacgg
ttcgcccaggcagtctcctcgacgctcctgtacttcaacgacctgcttgagcacgagacc
ggtctcccgagcagcgactacggccgtgtcatgggtaccgctgtcgggttctcgttcttc
agccactcgatctacggtggcggcggccccggtatcttcaacggcaaccacgtcgtgacc
cgccacgcaaacggtgtggccatcccgtgtgtggtcgctgcagcggcactcgatgccgga
acccagatgttctcgcccgagaacacgtcgaagatcttcgccgacacctacggtaagatc
gatgtgttcaacaagccgatcaaccagatcgcaaacggagcctga

DBGET integrated database retrieval system