KEGG   Methanoculleus bourgensis: BN140_1739Help
Entry
BN140_1739        CDS       T02189                                 

Gene name
mtrE
Definition
(GenBank) tetrahydromethanopterin S-methyltransferase subunit E
  KO
K00581  tetrahydromethanopterin S-methyltransferase subunit E [EC:2.1.1.86]
Organism
mbg  Methanoculleus bourgensis
Pathway
mbg00680  Methane metabolism
mbg01100  Metabolic pathways
mbg01120  Microbial metabolism in diverse environments
mbg01200  Carbon metabolism
Module
mbg_M00567  Methanogenesis, CO2 => methane
mbg_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mbg00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    BN140_1739 (mtrE)
Enzymes [BR:mbg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     BN140_1739 (mtrE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrE
Motif
Other DBs
NCBI-GeneID: 13355148
NCBI-ProteinID: CCJ36662
UniProt: I7LK63
Position
1767963..1768862
Genome map
AA seq 299 aa AA seqDB search
MEEIIFGIGITALAGALATVAGAAEDTESDIGSQGDPNSQVQLAPQMGYIHRIFNKAVAG
EPPAYGLWVALGAGLAWAFMAMQINPILAIVLGSALAVFVQGVYATTAYLGRTASLAKFE
QPVYIDILKSMTTVTMAHAFVAIFATVAMCHLIISALGHPFPLPLLGLVWGIALGAAGSA
TGNPFYGKERQYQEQKFGAGVPISASGNIVRYAEAGQRNSLDNGFFSAKLGGPASGICFG
LIVFFELWRTVVFEPLAAGWGAVIVGVIVILIFAIIDRYIEVWARKTFGPYVAPEEASS
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggaagagattatatttggcatcggcattaccgcattggcaggtgctcttgcaaccgta
gccggcgctgcggaggatactgaatctgatatcggatcccagggagacccgaactcacag
gttcagctagccccgcagatgggatatattcaccgcattttcaacaaagcagttgccggt
gaacccccagcgtacggtctctgggttgcattgggagcaggccttgcctgggcatttatg
gcgatgcagataaacccgattcttgcaatcgtactcgggagcgctcttgcggtcttcgtg
cagggcgtttatgcgacaaccgcatatctcggtcgtactgcaagtctcgccaagttcgaa
cagccggtctacatcgatatcttaaagtcgatgacgaccgtgaccatggcacacgcgttt
gtagcgatctttgccaccgtcgcgatgtgtcacctgatcatcagcgcactcggccacccc
ttcccgctcccactgctgggtcttgtttggggtatcgcgctcggtgcagccggatctgca
accggtaacccgttctacggaaaggagcggcagtaccaggagcagaagttcggagccgga
gtcccgatctccgcgtccggtaacatcgtccgctacgccgaggccggccaacggaactcg
ctcgacaacggtttcttcagcgccaaactcggcggccccgcgtcgggtatctgtttcggc
ctgatcgtcttcttcgaactctggcgtaccgtggtcttcgagccgctcgccgccggatgg
ggagcggtcatcgtcggcgtcatcgtgatcctgatctttgccatcatcgaccgctacatc
gaggtctgggcaaggaagactttcggcccctacgtggcccctgaggaggcatcatcatga

DBGET integrated database retrieval system