KEGG   Methanoculleus bourgensis: BN140_2344Help
Entry
BN140_2344        CDS       T02189                                 

Gene name
asnB3
Definition
(GenBank) asparagine synthase (glutamine-hydrolysing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mbg  Methanoculleus bourgensis
Pathway
mbg00250  Alanine, aspartate and glutamate metabolism
mbg01100  Metabolic pathways
mbg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mbg00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BN140_2344 (asnB3)
Enzymes [BR:mbg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     BN140_2344 (asnB3)
Peptidases [BR:mbg01002]
 Cysteine Peptidases
  Family C44
   BN140_2344 (asnB3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase
Motif
Other DBs
NCBI-GeneID: 13355001
NCBI-ProteinID: CCJ37267
UniProt: I7LKS5
Position
complement(2484213..2485184)
Genome map
AA seq 323 aa AA seqDB search
MVYILVPNHISSKHRQGSVLRRPQSSRRPPVRLQSELNMNLKGWIELDGVRLSPADVERM
LKEGPEPLKRCGGEFLLTWDDCTARDAFGIMPGPVPPGAVCCGGRAVARIAPDPPSCTLE
EAIITAVDLRSDEGVVAFSGGVDSGLIAGLADLPCVAVGIEGSHDIIWATKAALMMKLDL
EVVTPTEEEVVEALARVVRVIPDPANPVEASIATTLFFVAARARELGHTRILAGQGADEL
FGGYARYLSSPDLAAELERDVVDHKRQRARDQAVAALHGTYFSMPYLDIRVVRAAQAIPS
GEKVCGGGAKTPPPGGRRTSYPR
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggtatacatattagttccaaaccatattagttccaaacaccggcaaggatctgttttg
aggcgaccgcagtcctcacggagaccccctgtccggttacagagcgagctaaatatgaac
ctcaagggctggatcgaactcgacggggtgcggctctcccccgccgacgtggagcggatg
ctcaaagaggggcctgagcccctcaagagatgcggcggcgagttcctgctcacctgggac
gactgcaccgcccgcgacgccttcgggatcatgcccggcccggtccccccgggggccgtc
tgctgcggcgggcgggcggtagcccggatagcccctgatcccccatcctgcacgctcgag
gaggcgatcatcaccgcggtcgacctcaggagcgacgaaggggtggtggcgttctcaggc
ggggtggactcaggcctcatcgccgggcttgccgatctcccctgcgtggcggtagggatc
gaggggtcgcacgacatcatatgggcgacgaaggccgccctgatgatgaaacttgacctc
gaggtcgtcaccccgacagaagaggaggtcgtagaagcgcttgcccgggtggtcagggtg
atcccggacccggcaaacccggtcgaggcctcgatcgcgacgaccctcttcttcgtcgcc
gcccgggcgcgggagctcgggcatacccggatcctcgccgggcagggggcggacgagctc
ttcggcggctacgcccgctacctctcctcccctgacctcgcggcagaactcgagcgggac
gttgtggaccacaagcgccagagggcgcgggaccaggcggtggcggcgctccacgggacg
tacttctcgatgccctacctcgacatccgggtggtgcgcgccgcacaggcgatcccgtcc
ggtgagaaggtgtgcggggggggtgcgaaaacgccccctccgggcggtcgcagaacgtca
tatccccgctga

DBGET integrated database retrieval system