KEGG   Mycoplasma bovis Hubei-1: MMB_0099Help
Entry
MMB_0099          CDS       T01568                                 

Gene name
pdhC
Definition
(GenBank) dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mbh  Mycoplasma bovis Hubei-1
Pathway
mbh00010  Glycolysis / Gluconeogenesis
mbh00020  Citrate cycle (TCA cycle)
mbh00620  Pyruvate metabolism
mbh01100  Metabolic pathways
mbh01110  Biosynthesis of secondary metabolites
mbh01120  Microbial metabolism in diverse environments
mbh01130  Biosynthesis of antibiotics
mbh01200  Carbon metabolism
Module
mbh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mbh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MMB_0099 (pdhC)
   00020 Citrate cycle (TCA cycle)
    MMB_0099 (pdhC)
   00620 Pyruvate metabolism
    MMB_0099 (pdhC)
Enzymes [BR:mbh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MMB_0099 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Trans_coact
Motif
Other DBs
NCBI-ProteinID: AEI89813
Position
112009..112743
Genome map
AA seq 244 aa AA seqDB search
MAVELAKVKPLEEKEAPISGIRKAIAKNLKEVLETSAYCSLVLKADVTNLWNLRAKVKDK
VFEEHNIKLTFLSWIVKASAIALSEYPSFAARWDGVEGKVYYPGTLNIAIAVDTPFGLFV
PVIRGVENLSIIEIQKEIVRLSTLAREKKLKMSDMTGGCFAITNVGSAGVLFGSPIMNKG
NTAISATGAIIDELKLNKEGAVENRKVMYLSIAADHQWVDGADMARFQGRIKELIENPEQ
LGEF
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggctgttgagctcgcaaaagttaaaccactagaagaaaaagaagctcctatttcagga
attcgtaaagctattgctaaaaacttaaaagaagttttagaaacatctgcatattgttca
ttagttttaaaagctgatgttacaaatctttgaaacttacgtgcaaaagttaaagacaaa
gtttttgaagaacacaatattaaattaacattcctatcatgaatagttaaagcctcggct
attgctttaagcgaatacccatcttttgctgctagatgagatggtgttgaaggtaaagta
tactaccctggaacacttaacattgctatagctgttgacacacctttcggtctatttgta
cctgtaattagaggtgttgaaaacctaagtataattgaaattcaaaaagaaattgttaga
ttatcaacacttgcaagagaaaagaagctaaaaatgtcagatatgacaggtggctgcttt
gctattacaaacgttggtagtgccggtgtattattcggttctccaattatgaacaaaggc
aatacagcaatttcagctactggtgcaatcattgatgagttaaaattaaacaaagaaggt
gctgttgaaaacagaaaagtaatgtacttatcaatagcagctgaccaccaatgagttgat
ggtgctgatatggctcgtttccaaggcagaattaaagaattaatcgaaaatccagaacaa
ttaggagaattttaa

DBGET integrated database retrieval system