KEGG   Candidatus Izimaplasma sp. HR1: KQ51_00243
Entry
KQ51_00243        CDS       T03291                                 

Gene name
oraE
Definition
(GenBank) D-ornithine 4,5-aminomutase subunit beta
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
mbj  Candidatus Izimaplasma sp. HR1
Pathway
mbj00472  D-Arginine and D-ornithine metabolism
mbj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    KQ51_00243 (oraE)
Enzymes [BR:mbj01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     KQ51_00243 (oraE)
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: AIO18146
UniProt: A0A088SZP5
Position
complement(219612..221816)
AA seq 734 aa
MNNIKPNEKLDIRELLKDLENYVPRKRGWVWRDISPQKIGQFTYEQASPGLKNFVPLPSA
RGLGNIDPQPDAVITTEIASGRFEDDIRRMRMAAYHGADHIMVIRTAGQSHFDGLLEGTP
QGIGGIPVTRKQLRAQRKALDIIEEEVGRPINYHSYVSGVAGPEIAVLFTEEGVNGAHQD
PQYNVLYRNINAIRSFVDAAESKKVMAYASMAQIDGAHNANATARDAWKVMPELLVQHII
NSRFSERIGIKAENICLSTVPPAASPTPDLKLNLPYAVALREFLSDYKMRAQMNTKYMDS
STREATVTHVLNLLISRLTSADIQSTITPDEGRNVPWHIYNIEALDTAKQAMVGMDDLLS
MVSLKETGYLQDAKREIQERSILMMEEIIEMGGYFNAVEAGMFVDSGEYPERNGDGISRD
LNGGVGAGTVVKRDVDYLAPVTAHYGYNNVEQYDKSAKNDPSMLIGGCTFEKPEMVKFID
ELDDTDNVYLRMDVTEKYRSGKVLKPEVQWLGDGTVTVDLFFPTHIRTAEAAALVTGKKM
NLSDVEVIHKEILHPSEGTRIQIKGTFNFDINVDQLVLPEEIKVHSEDEIIQYVKDNPIR
VVAGTAGNDEHSVGIREVLDIKHGGIEKYGIKYEYLGTSVPIEKFVDAAIETNSQVIMMS
TIISHDDIHYKSMIKLHNYAVEKGVRDKLILIAGGTQVTPEIARTNKMDQGFGRGTKGIQ
IASFVLDKFRNMSK
NT seq 2205 nt   +upstreamnt  +downstreamnt
atgaataatataaaaccaaatgagaagttagatataagagaattactaaaagacttagaa
aactatgtacccagaaaacgtggatgggtatggagagatatatcacctcaaaaaataggg
cagtttacctatgaacaggcaagtcctggtttgaaaaactttgttcctctacctagtgct
agagggctcggaaacatagatcctcaacccgatgctgtaattactacagaaattgcatca
ggacgttttgaagatgatattagacgtatgagaatggccgcttatcatggggcagatcat
attatggttataagaacagctgggcaatctcactttgatggattgctcgaaggaacacct
caagggattggaggaatacctgttactcgtaagcaacttagagctcagcgcaaagcatta
gatatcatagaggaggaagtagggagacctattaactatcatagttatgtatccggtgta
gctggacctgaaattgccgtattattcactgaagaaggcgttaatggtgcacatcaggat
ccccaatataatgtcctatatagaaatataaatgcaataagaagttttgttgatgctgct
gaaagtaaaaaggttatggcatacgcgtcgatggctcaaatcgatggggctcataacgca
aatgctacagcaagagacgcttggaaagtaatgccggaacttcttgtacaacatataatc
aattcgcgctttagtgagagaattggtataaaagctgagaacatttgcttatctacggta
ccgcctgcagcttctccaactccagatttaaaattgaatcttccttatgcagtagctcta
agagaatttttaagtgattataagatgagagctcaaatgaatactaagtatatggatagt
tcaactagagaagctacagtgacacatgtactaaacctactaatttctagacttacaagt
gctgatattcaatcaactattactcctgatgaaggtagaaacgttccatggcatatttat
aacatagaagcattagatacagctaaacaagctatggttggaatggatgatttactaagc
atggtcagcctcaaggaaacaggttatctccaagatgctaaaagagagattcaagaacga
tctattctaatgatggaagaaattattgaaatgggtggatatttcaatgcagttgaagca
ggaatgtttgttgatagcggagagtatcctgagagaaatggcgacggaattagtcgtgat
ttgaatggtggtgtaggtgcagggactgttgttaaacgagatgttgactacctagcacca
gtgacagcacattatggttataataatgtagagcaatacgataaatcagctaaaaatgat
ccatctatgttaattggagggtgtacttttgaaaaaccagagatggttaagtttattgat
gaacttgatgacaccgataatgtatatttaagaatggacgtaactgagaaatatcgctca
ggtaaagtgttaaaacctgaagttcaatggcttggggatggaactgtaacagtagattta
ttcttcccaacacacatcagaactgcggaggcagcagcccttgtgactggtaaaaagatg
aatttgagcgatgtagaagtaattcataaagaaatactacatcctagtgaaggtacaaga
attcagattaaaggtacatttaattttgatattaatgttgaccaattagtgttacctgag
gaaataaaggtacattcagaggatgagattatacaatatgttaaggataatcctatcaga
gtagttgctggtactgcaggtaatgatgaacattccgttggtattagagaagtacttgat
attaagcatggtggtattgaaaaatacggaatcaaatatgaatatctgggtacatcggta
cctattgaaaaatttgtagacgcagctatcgaaactaattctcaagttattatgatgtca
acaataatttcgcatgatgatattcattataaaagtatgattaaactacacaactacgcc
gttgaaaagggtgttagagataaattgatactaatcgcaggtggtacgcaagttactcct
gagatagcaagaacaaataagatggatcaaggatttggtagaggtactaaaggtattcaa
attgctagttttgttttagacaaatttcgaaatatgagtaagtaa

DBGET integrated database retrieval system