KEGG   Candidatus Izimaplasma sp. HR1: KQ51_01049Help
Entry
KQ51_01049        CDS       T03291                                 

Gene name
thlA
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mbj  Candidatus Izimaplasma sp. HR1
Pathway
mbj00071  Fatty acid degradation
mbj00280  Valine, leucine and isoleucine degradation
mbj00310  Lysine degradation
mbj00380  Tryptophan metabolism
mbj00620  Pyruvate metabolism
mbj00630  Glyoxylate and dicarboxylate metabolism
mbj00640  Propanoate metabolism
mbj00650  Butanoate metabolism
mbj00900  Terpenoid backbone biosynthesis
mbj01100  Metabolic pathways
mbj01110  Biosynthesis of secondary metabolites
mbj01120  Microbial metabolism in diverse environments
mbj01130  Biosynthesis of antibiotics
mbj01200  Carbon metabolism
mbj01212  Fatty acid metabolism
mbj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mbj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    KQ51_01049 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    KQ51_01049 (thlA)
   00640 Propanoate metabolism
    KQ51_01049 (thlA)
   00650 Butanoate metabolism
    KQ51_01049 (thlA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    KQ51_01049 (thlA)
   00072 Synthesis and degradation of ketone bodies
    KQ51_01049 (thlA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KQ51_01049 (thlA)
   00310 Lysine degradation
    KQ51_01049 (thlA)
   00380 Tryptophan metabolism
    KQ51_01049 (thlA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    KQ51_01049 (thlA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KQ51_01049 (thlA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    KQ51_01049 (thlA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mbj04147]
    KQ51_01049 (thlA)
Enzymes [BR:mbj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     KQ51_01049 (thlA)
Exosome [BR:mbj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KQ51_01049 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: AIO18928
UniProt: A0A088T1W3
Position
1079044..1080255
Genome map
AA seq 403 aa AA seqDB search
MSKVYIVSAKRTPIGSFLGTLSKLHPAKYASDVVKNMLEETKVPAAEIDELVIGNILPAG
LGQGMGRQVSIGAGIPVEVPAYSLNMVCGSGMKSVMNSYVNIKANMFNLVIAGGTESMSK
APYLVPDKTRGGIKMGGFKLKDHMIDDALTDAFEQYHMGITAENIVDKYNLTREEQDAFA
INSQAKAIKAIDEGKFKDEIVPIEVKSRRETIIFENDEYPNRRTTLEKLGTLRAAFKKEG
SVTAGNSSGINDGASFVMVASEEAVKKYNLKPLVEIVSIGQGGVDPSIMGMGPVPAIKQA
LKNADMKLSEIDLLELNEAFAAQSLGVVTELVKQHDLTKEEIIERTNVNGGAIALGHPVG
ASGNRILVTLIHEMKKRNNANGLASLCIGGGMGTAIIVKNMEE
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagtttatattgtttccgcaaaaagaactcctattggtagttttttaggaaca
cttagtaagctgcatcctgcaaaatatgcaagtgatgtcgttaaaaacatgttagaagaa
acaaaagtacctgctgctgagattgatgaattagttataggtaatatcttacctgctggt
ttaggtcaaggtatgggtagacaagtttctattggtgcaggaattcctgttgaagtacct
gcttatagtttaaatatggtttgtggtagtggtatgaaatcagttatgaattcatacgtt
aatatcaaagcaaatatgtttaatttagtaattgctgggggaacagaatcaatgagtaag
gctccatacttagtcccagataaaactcgtggtggaattaaaatgggtggatttaaactt
aaagatcatatgattgatgatgctttaactgatgcatttgaacaatatcatatgggtatt
actgctgaaaatatcgttgataaatataatcttacaagagaagaacaagacgcatttgct
ataaattcacaagcaaaagcaattaaagctattgatgagggaaaatttaaagatgaaata
gttcctatcgaagtaaaatcaagaagagaaactatcatttttgaaaacgatgaatatcca
aatcgtcgaactacattagaaaaattgggaacattaagagctgctttcaaaaaagaaggt
agtgtaactgcgggtaactcttcaggaattaatgatggtgctagttttgttatggtagct
tcagaagaagcagttaaaaaatataatttaaaacctttagtagaaatcgtttctatagga
caaggtggagtagatccaagtattatgggtatgggtccagttcctgcaataaaacaagct
ttaaaaaatgctgatatgaaattatcagaaatagatttattagaattgaatgaagcattc
gcagcacaaagtttaggtgttgttactgaattagttaagcaacatgatttaactaaagaa
gaaatcatagaacgtactaacgtaaatggtggagctattgcattaggtcatccagttggt
gcaagtggaaatagaattttagtaacattaattcatgaaatgaaaaaacgaaacaatgca
aatggattagcttcattatgtattggtggcggtatgggtactgctataatcgttaaaaat
atggaggaataa

DBGET integrated database retrieval system