KEGG   Candidatus Izimaplasma sp. HR1: KQ51_01096Help
Entry
KQ51_01096        CDS       T03291                                 

Gene name
gcvT
Definition
(GenBank) Aminomethyltransferase
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
mbj  Candidatus Izimaplasma sp. HR1
Pathway
mbj00260  Glycine, serine and threonine metabolism
mbj00630  Glyoxylate and dicarboxylate metabolism
mbj00670  One carbon pool by folate
mbj01100  Metabolic pathways
mbj01110  Biosynthesis of secondary metabolites
mbj01130  Biosynthesis of antibiotics
mbj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mbj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    KQ51_01096 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KQ51_01096 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    KQ51_01096 (gcvT)
Enzymes [BR:mbj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     KQ51_01096 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C SoxG
Motif
Other DBs
NCBI-ProteinID: AIO18973
UniProt: A0A088T232
Position
1133154..1134242
Genome map
AA seq 362 aa AA seqDB search
MKRTALYDAHVKLGAKIVDFAGYEMPISYTSITEEHNYVRNKCGIFDVSHMGEICVRGDE
AAQFVDHIFTNDVLSMHDNQVLYGMMCYPTGGVVDDLLVYKFNDKHFLLVVNASNVDKDY
AWVLENNTFDCKVSNESEHFAEVALQGPYAQTLLQELTSFNLSEITFFTCKNINVNGALV
LVSRTGYTGEDGFEIYGTHSDIVDIWNQLIEKGKDNISPIGLGARDTLRFEVALPLYGNE
LSKDITPLEAGLGFAVRLNSGDFIGKDVLVKQKEQKTTRRVCGIKLLDKGVIRHGYQVFH
ENKLVGEVTTGYKSPSTGETVALAMVDRPYDKLGTELTVEVRGKMKNVVVRTKKFYNKNY
KK
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaacagcattgtatgacgctcacgttaaattaggagcaaagatagttgatttc
gcaggatatgaaatgccaatttcatatacatcaataacggaagaacataactatgtaaga
aataaatgtggaatattcgatgtatcacatatgggggaaatatgtgttcgaggagatgaa
gctgcacagtttgttgatcatatctttacaaacgatgtactttcaatgcatgacaatcaa
gtactatatggaatgatgtgttatccaacaggaggagttgttgatgatttattagtttat
aagttcaatgacaaacatttcttattagttgtaaatgcttcaaatgtagataaagattat
gcttgggttttagagaataatactttcgattgtaaagtgtctaacgagtcagaacatttc
gctgaagttgctctacaaggaccttacgcacaaacgttactacaggaattaactagtttt
aatctaagtgaaattacattctttacatgtaaaaatataaatgttaatggtgctttagtt
ctagtttctagaactggatatactggtgaagacggatttgaaatatatggaacacatagt
gatattgtcgatatttggaatcaacttatcgaaaaaggtaaagacaatatctcaccaatc
ggtcttggagctcgagatacacttcgttttgaagtagcattaccactttatggtaatgaa
ctttcaaaagatattacaccattagaagcaggattaggatttgcagttagattaaattct
ggagattttataggaaaagatgttttagttaagcaaaaagagcaaaaaactacaagaaga
gtttgtggtataaaattactagataaaggggttattagacatggatatcaagtattccat
gagaataaattagtaggagaagttactactggatataaatcacctagtacaggtgaaact
gttgctttagcgatggttgatcgtccatatgataaacttggaacggaactaactgttgaa
gtaagaggtaaaatgaaaaatgttgttgtaagaacaaaaaagttttataataaaaattat
aagaaatag

DBGET integrated database retrieval system