KEGG   Candidatus Izimaplasma sp. HR1: KQ51_01143Help
Entry
KQ51_01143        CDS       T03291                                 

Gene name
argS
Definition
(GenBank) Arginine--tRNA ligase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
mbj  Candidatus Izimaplasma sp. HR1
Pathway
mbj00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mbj00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    KQ51_01143 (argS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mbj01007]
    KQ51_01143 (argS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mbj03016]
    KQ51_01143 (argS)
   03029 Mitochondrial biogenesis [BR:mbj03029]
    KQ51_01143 (argS)
Enzymes [BR:mbj01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     KQ51_01143 (argS)
Amino acid related enzymes [BR:mbj01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   KQ51_01143 (argS)
Transfer RNA biogenesis [BR:mbj03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    KQ51_01143 (argS)
 Prokaryotic type
   Other AARSs
    KQ51_01143 (argS)
Mitochondrial biogenesis [BR:mbj03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    KQ51_01143 (argS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DALR_1 Arg_tRNA_synt_N tRNA-synt_1d tRNA-synt_1g tRNA-synt_1e tRNA-synt_1f tRNA-synt_1
Motif
Other DBs
NCBI-ProteinID: AIO19020
UniProt: A0A088T1Y8
Position
1178149..1179801
Genome map
AA seq 550 aa AA seqDB search
MKLNELLQKVKDSLKVCLTELGYFDENIEIILETPKDKTNGDLSSNVAMRYARIARKAPF
MIAEEIKNALNTKGLFVKEVVVAKPGFINFFLDKTFLLETITEINKLGSNFGNLEMGKDE
HYNIEFVSVNPTGALHIGHARGAAAGDSLSRILQKAGYKVTKEYYVNDAGNQIHNLALSI
DARYKQLFNQKVDLPEDGYRGPEIIETAKEIKAIHNDKFLNEDGYEFFREYGVESLLVLL
RKDLKAFNVEFDVWFSEKSLYDNKLVKETIDYLIKNDYTYEEEGAIWLKTSDYEDEKDRV
IIKSDKTFTYLTPDIAYHKNKLDRGYTKLIDILGGDHHGYINRLKAAIEMVGGKSDLLEV
ELLQMVKVLQNGIEVKMSKRSGKAIVLSDLVEEVGSDPIRYFFAARSLSTQMDLDLDLAI
RQTNENPVYYVQYAHARINSIFEAAKTKGVDISNLPTEFKTIANPKAFELVNILANYPNI
IEQSATQRAPHKLTNYIQQLASAFHSFYNAEQVITTDQLKTREHLSLLNAAKIILKDSLS
LIGVSAPNKM
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgaaactaaatgaattattacaaaaagtaaaagactctctaaaagtatgtttaactgag
ttaggttactttgatgagaacattgagataatactcgaaactccaaaagacaaaacaaat
ggagatttatcttctaatgtggcgatgcgttatgcaagaattgctagaaaagctccattt
atgattgctgaagaaataaagaatgctctaaacacaaagggattatttgtaaaagaagta
gttgtagctaagccaggttttatcaatttctttttagataaaacatttttacttgaaaca
attactgaaataaataagcttggtagtaactttggtaacttggaaatgggaaaagatgaa
cactataatatcgaatttgtttctgttaatcctacaggtgcacttcatataggacatgcc
cgtggggcagctgctggtgattctctaagtagaatcctccaaaaagcaggatataaagta
acgaaggaatattatgttaatgatgctggaaaccagatacataacctggctttaagtatt
gatgctagatacaaacaattgtttaatcaaaaagttgatttacctgaagatggatatcgt
ggaccagaaataattgaaacagcaaaggaaataaaagcaatccacaatgataaattctta
aacgaggacggatatgagttctttagagaatatggggttgaatctcttcttgttttatta
cgtaaagacttaaaagcttttaatgtcgaatttgatgtatggtttagtgaaaaatcatta
tacgataacaaacttgtcaaagaaacaattgattacttaattaagaatgattacacctat
gaagaagaaggtgcaatttggctcaaaacaagcgattatgaagatgagaaggatcgtgta
attatcaaaagtgataaaacatttacatatctaacacctgatattgcttaccataaaaac
aaactagatagaggttatactaaactaattgatattcttggtggagaccatcatggatat
attaaccgtttaaaagctgctattgaaatggttggaggaaaaagtgatttacttgaagta
gaactccttcaaatggttaaagtgttacaaaatggtatcgaagtaaaaatgagtaaacgt
agtggtaaggcaatcgttctatctgatttagtagaagaagtaggtagcgacccaattaga
tatttctttgcagctagaagtcttagtacacaaatggatttagatttagacttagcaata
agacaaactaatgaaaatcctgtttactatgtacaatacgctcatgccagaattaacagt
atttttgaagctgctaaaacaaaaggagtagatatatcaaatctaccaacagaattcaaa
acaatagctaacccgaaagcatttgagttagttaacatattagcaaattatcctaacata
atcgaacaatcagcaacacaaagagcaccacataaattaacaaactatatccaacaacta
gcaagtgcattccatagtttttacaatgcagaacaagtaataactactgaccaattaaaa
actagagaacacttgtcacttcttaatgcagcaaaaataattttaaaagatagtctttct
cttattggagtaagtgcaccaaacaaaatgtaa

DBGET integrated database retrieval system