KEGG   Mycobacterium tuberculosis variant bovis BCG Korea 1168P: K60_010790Help
Entry
K60_010790        CDS       T02451                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mbk  Mycobacterium tuberculosis variant bovis BCG Korea 1168P
Pathway
mbk00450  Selenocompound metabolism
mbk00970  Aminoacyl-tRNA biosynthesis
mbk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    K60_010790
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    K60_010790
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mbk01007]
    K60_010790
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mbk03016]
    K60_010790
Enzymes [BR:mbk01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     K60_010790
Amino acid related enzymes [BR:mbk01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   K60_010790
Transfer RNA biogenesis [BR:mbk03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    K60_010790
 Prokaryotic type
   Other AARSs
    K60_010790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AGE66989
Structure
PDB: 

Position
complement(1126266..1127825)
Genome map
AA seq 519 aa AA seqDB search
MKPYYVTTAIAYPNAAPHVGHAYEYIATDAIARFKRLDGYDVRFLTGTDEHGLKVAQAAA
AAGVPTAALARRNSDVFQRMQEALNISFDRFIRTTDADHHEASKELWRRMSAAGDIYLDN
YSGWYSVRDERFFVESETQLVDGTRLTVETGTPVTWTEEQTYFFRLSAYTDKLLAHYHAN
PDFIAPETRRNEVISFVSGGLDDLSISRTSFDWGVQVPEHPDHVMYVWVDALTNYLTGAG
FPDTDSELFRRYWPADLHMIGKDIIRFHAVYWPAFLMSAGIELPRRIFAHGFLHNRGEKM
SKSVGNIVDPVALAEALGVDQVRYFLLREVPFGQDGSYSDEAIVTRINTDLANELGNLAQ
RSLSMVAKNLDGRVPNPGEFADADAALLATADGLLERVRGHFDAQAMHLALEAIWLMLGD
ANKYFSVQQPWVLRKSESEADQARFRTTLYVTCEVVRIAALLIQPVMPESAGKILDLLGQ
APNQRSFAAVGVRLTPGTALPPPTGVFPRYQPPQPPEGK
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgaagccctattacgtcaccaccgcgatcgcatatcccaacgctgcaccccacgtaggt
cacgcctacgaatacatcgccaccgacgcgatcgcccggttcaaacggctggatggctat
gacgtgcgcttcctgaccgggaccgacgagcatggcctgaaggtcgcacaagccgccgcg
gcagcgggcgtgcccaccgcggcgcttgcccggcgcaattccgacgtgtttcagcgcatg
caggaggcgctgaacatctccttcgaccgattcatccgcactaccgatgccgaccaccac
gaggcgtccaaggaactctggcgacggatgtcggcggccggcgacatctatctggacaac
tattccgggtggtactcggtgcgcgacgagcggttcttcgtcgaatcggagacccaactt
gtcgacggcacgcgcctgacggtagagaccggcacgccggtgacctggaccgaggagcag
acctacttcttccggctgtcggcctataccgacaagctgctggcccactatcacgccaac
cccgacttcatcgcgccggagacgcggcgcaacgaagtgatcagcttcgtctccggcggc
ctggacgacctgtcgatctcgcgcacctcgtttgactggggtgtgcaggtgcccgagcac
cccgaccacgtcatgtacgtctgggtcgacgcgctgaccaattacctgaccggggcgggc
ttcccggataccgactcggagttgttccgccgctactggcccgccgatttgcacatgatc
ggcaaggacatcatcaggtttcatgccgtctattggccggcgtttttgatgtcagccgga
atcgagttgccgcgaaggatcttcgcgcacgggttcttgcacaaccgcggcgagaagatg
agtaaatcggtgggcaacatcgtcgacccggttgccctggcggaagcgctcggggtggac
caggtccgctacttcctgttgcgggaggtcccgttcggccaggacggcagttacagcgac
gaggccatcgtcactcggatcaacaccgatctggccaacgagctcggcaacttggcccaa
cgctcgttgtcgatggtggccaaaaaccttgacggcagggtgcccaacccgggtgagttc
gccgacgccgacgccgcgttgcttgcgaccgccgatggcttgttggagcgagtgcgcggt
cacttcgacgcacaggcgatgcacctggcgctggaggcgatctggctgatgctcggcgac
gcgaacaagtacttttcggtgcagcagccgtgggtactgcgcaagagcgagtccgaagcc
gatcaggcccggttccgcaccacgctctacgtcacctgcgaggtagtccgcatcgcggca
ctgctgatccagccggtgatgccggagtcggccggcaaaattttggacctgctcggccag
gccccaaaccagcggtcgttcgccgccgtaggtgttcggctgacccccggcacagcgctg
ccgccgcccaccggggtatttccccgctaccagccgccgcaaccacccgaaggcaagtga

DBGET integrated database retrieval system