KEGG   Mycobacterium bovis BCG Korea 1168P: K60_016820Help
Entry
K60_016820        CDS       T02451                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
mbk  Mycobacterium bovis BCG Korea 1168P
Pathway
mbk00340  Histidine metabolism
mbk01100  Metabolic pathways
mbk01110  Biosynthesis of secondary metabolites
mbk01230  Biosynthesis of amino acids
Module
mbk_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:mbk00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    K60_016820
Enzymes [BR:mbk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     K60_016820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AGE67592
Position
1775039..1776373
Genome map
AA seq 444 aa AA seqDB search
MTAPPPVLTRIDLRGAELTAAELRAALPRGGADVEAVLPTVRPIVAAVAERGAEAALDFG
ASFDGVRPHAIRVPDAALDAALAGLDCDVCEALQVMVERTRAVHSGQRRTDVTTTLGPGA
TVTERWVPVERVGLYVPGGNAVYPSSVVMNVVPAQAAGVDSLVVASPPQAQWDGMPHPTI
LAAARLLGVDEVWAVGGAQAVALLAYGGTDTDGAALTPVDMITGPGNIYVTAAKRLCRSR
VGIDAEAGPTEIAILADHTADPVHVAADLISQAEHDELAASVLVTPSEDLADATDAELAG
QLQTTVHRERVTAALTGRQSAIVLVDDVDAAVLVVNAYAAEHLEIQTADAPQVASRIRSA
GAIFVGPWSPVSLGDYCAGSNHVLPTAGCARHSSGLSVQTFLRGIHVVEYTEAALKDVSG
HVITLATAEDLPAHGEAVRRRFER
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcgccgccgcccgtgcttacccgtatcgacttgcggggagccgagttgacagct
gccgagctgcgggccgctctgccacgcggcggcgccgatgtggaagccgtgctgccgacg
gtacggcccattgtggcggccgtcgccgagcgcggggccgaggccgcgctggacttcggc
gcatcgttcgacggtgtgcggccccatgccatccgggtgccagacgcagcgctggacgcg
gcgctggccggactggactgcgacgtctgcgaagcgttgcaggtgatggtcgagcggacc
cgcgccgtgcactccgggcagcgtcgcaccgacgtcacaaccacactgggcccgggcgcg
acggtcaccgagcggtgggttccggtcgagcgggtaggcctgtacgtgccggggggcaat
gcggtgtacccatccagcgtggtgatgaacgtggtgcccgcccaagccgcgggcgtcgac
tcgttggtggtagccagcccgccgcaggcgcagtgggatggaatgccgcatccgaccatt
ctggccgcggcccggctgctgggcgtcgatgaggtctgggcggtcggcggcgctcaggcg
gtggcgttgctggcttacggcggcaccgacaccgacggcgcagcactgacaccggtcgac
atgatcaccgggcctggcaacatctatgtcacggccgccaagcgactgtgccgttcgcgg
gtgggcatcgacgccgaagcggggccaaccgagatcgctatcctcgccgatcacaccgcc
gacccggtgcatgtggccgccgacctgattagccaggccgaacacgacgagttggctgcc
agcgtgctggtcactccgagtgaggacctggccgatgccaccgacgccgaactggctggc
cagctgcagactacggtgcaccgcgaacgggtgacggccgcgctgaccggacgccaatcg
gcgatcgtcctggtcgacgacgtggacgccgccgtcttggtggtgaacgcttacgccgct
gagcatttggagattcagaccgccgatgccccgcaggttgccagccggatccgctcggcg
ggagccattttcgtcggcccgtggtccccggtgagcctcggcgactactgcgcgggatcc
aaccatgtactgccgaccgcgggctgcgcccggcattccagcggcctgtcggtgcagacg
ttcctgcgcggcatccacgtcgtggaatacacggaggcggccctcaaagacgtttccgga
cacgtgatcacgctcgccacggccgaggacttgccggcgcacggtgaggcggtacggcgg
aggttcgagcgatga

DBGET integrated database retrieval system