KEGG   Mycobacterium bovis BCG Korea 1168P: K60_019540Help
Entry
K60_019540        CDS       T02451                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mbk  Mycobacterium bovis BCG Korea 1168P
Pathway
mbk00071  Fatty acid degradation
mbk00072  Synthesis and degradation of ketone bodies
mbk00280  Valine, leucine and isoleucine degradation
mbk00310  Lysine degradation
mbk00362  Benzoate degradation
mbk00380  Tryptophan metabolism
mbk00620  Pyruvate metabolism
mbk00630  Glyoxylate and dicarboxylate metabolism
mbk00640  Propanoate metabolism
mbk00650  Butanoate metabolism
mbk00900  Terpenoid backbone biosynthesis
mbk01100  Metabolic pathways
mbk01110  Biosynthesis of secondary metabolites
mbk01120  Microbial metabolism in diverse environments
mbk01130  Biosynthesis of antibiotics
mbk01200  Carbon metabolism
mbk01212  Fatty acid metabolism
mbk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mbk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    K60_019540
   00630 Glyoxylate and dicarboxylate metabolism
    K60_019540
   00640 Propanoate metabolism
    K60_019540
   00650 Butanoate metabolism
    K60_019540
  09103 Lipid metabolism
   00071 Fatty acid degradation
    K60_019540
   00072 Synthesis and degradation of ketone bodies
    K60_019540
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    K60_019540
   00310 Lysine degradation
    K60_019540
   00380 Tryptophan metabolism
    K60_019540
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    K60_019540
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    K60_019540
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    K60_019540
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mbk04147]
    K60_019540
Enzymes [BR:mbk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     K60_019540
Exosome [BR:mbk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   K60_019540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C
Motif
Other DBs
NCBI-ProteinID: AGE67864
Position
2086878..2088362
Genome map
AA seq 494 aa AA seqDB search
MPVDPRTPVLIGYGQVNHRGDIDAEKQSIEPVDLMAAAARKAADSTVLEAVDSIRVVHML
SAHYRNPGQLLGERIKARTFTTGYSGVGGNMPQSLVNRACLDIQRGRAGVVLLAGAETWR
TRTGLRAKGSKLEWTVQDESVPLPDMAGDDVPMAGAAELRINLDRPAYVYPIFEQALRIA
YGESIENHRKRIGELWARFSAVAADNPHAWIRNPVTADEIWQPGPQNRMVSWPYTKLMNS
NNMVDQGAALLLTSVERATRLRIPAERWVYPQAGTDAHDTPAVADRHRLHRSTAIRIAGA
RALELAGLGLDDIEYVDLYSCFPSAVQVAAIELGLDTDDPARPLTVTGGLTFAGGPWSNY
VTHSIATMAELLAANPGRRGLITANGGYLTKHSFGVYGTEPPSEFRWEDMQPAVDREPTG
DGLVEWEGIGTVEAWTTPVNRDGQPEKAFLAVRTPDGSRSLAVITDPASVQATVREDIAG
VKVAVAPDGTATLR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgccggtagaccccaggacgccagtgctgatcggctatggacaggtcaaccaccgaggc
gacatcgacgccgagaagcagtccatcgaacccgtcgacctgatggccgccgcggcccgg
aaagccgcggattcgacggtgctcgaggcggtggattcgatccgtgtggtgcacatgctg
tcggcgcattaccggaatcccgggcagctcctcggcgaacgaatcaaggcgaggaccttc
accaccggttacagcggggtgggcggcaacatgccgcaatccctggtcaaccgggcatgc
ctggacatccagcgcgggcgggccggcgtggtgctgctggctggcgccgaaacctggcgc
acccgaacgggcctgcgcgccaagggcagcaaactggagtggactgtgcaggacgaatcc
gttccgctgccggacatggccggcgacgacgttccgatggccggtgcggctgagctgcgg
atcaacctggaccggccggcctacgtgtacccgatattcgagcaggcgctgcgcatcgcc
tacggcgagtcgatcgagaaccaccgaaagcggatcggcgagctgtgggcgcggttcagt
gccgtagctgctgacaacccgcacgcgtggatccgcaacccggttacggctgacgagatc
tggcagcccggcccacagaaccggatggtcagctggccctacaccaagcttatgaactcc
aacaacatggttgaccagggtgccgcgctgctgctgacgtcggtcgaacgtgcgacacgt
ctgcgaataccggccgaacgctgggtttatccacaggctggcaccgacgcccacgacaca
ccggccgtcgccgaccgccaccgactgcatcggtcgacggccattcggatcgccggtgcc
cgggcgctggaactggctgggctggggctcgatgacatcgaatacgtcgacctgtattcg
tgctttccctccgctgtccaagtcgccgcaatcgaactcggcctggacaccgacgatcct
gcccgcccgctgaccgtcaccgggggcctgaccttcgccggcgggccgtggagcaattac
gtcacgcactccatcgccaccatggctgaactgctggcggccaatcccgggcgccgaggt
ctgatcaccgccaacggcggttacctgaccaaacacagtttcggggtctacggcaccgag
ccgccgtcggaattccgctgggaggacatgcaacccgcggtcgatagggagcccaccgga
gatgggttggtcgagtgggaaggcatcggcaccgtcgaagcgtggaccacaccagtcaac
cgggacggacaacccgagaaggcgttcctggcggtgcgcacgcccgacgggtcgcgcagc
ttggccgtgatcaccgatcccgcatcggtgcaagcaacggtgcgcgaggacatcgccggc
gtcaaggttgccgtcgcccccgacggcaccgcgaccctgcgatag

DBGET integrated database retrieval system