KEGG   Mycobacterium tuberculosis variant bovis BCG Korea 1168P: K60_025410Help
Entry
K60_025410        CDS       T02451                                 

Definition
(GenBank) nucleoside diphosphate kinase ndkA
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
mbk  Mycobacterium tuberculosis variant bovis BCG Korea 1168P
Pathway
mbk00230  Purine metabolism
mbk00240  Pyrimidine metabolism
mbk00983  Drug metabolism - other enzymes
mbk01100  Metabolic pathways
mbk01110  Biosynthesis of secondary metabolites
mbk01130  Biosynthesis of antibiotics
Module
mbk_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
mbk_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
mbk_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:mbk00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    K60_025410
   00240 Pyrimidine metabolism
    K60_025410
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    K60_025410
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mbk04131]
    K60_025410
Enzymes [BR:mbk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     K60_025410
Membrane trafficking [BR:mbk04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    K60_025410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK TruB_C
Motif
Other DBs
NCBI-ProteinID: AGE68451
Structure
PDB: 

Position
complement(2680129..2680551)
Genome map
AA seq 140 aa AA seqDB search
MLGTVTERTLVLIKPDGIERQLIGEIISRIERKGLTIAALQLRTVSAELASQHYAEHEGK
PFFGSLLEFITSGPVVAAIVEGTRAIAAVRQLAGGTDPVQAAAPGTIRGDFALETQFNLV
HGSDSAESAQREIALWFPGA
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
gtgttgggcaccgtgaccgaacggactctggtactgatcaagccggatggcatcgaaagg
cagctgatcggcgagatcatcagccgcatcgagcgcaaaggcctcaccatcgctgcgctg
cagctcaggaccgtcagcgcggagttggccagccagcactacgccgaacatgaaggcaaa
ccattctttggatcgttgctggagttcatcacgtcgggtccggtggtagcggcgatcgtg
gagggaacccgagccatcgcggcggttcgccaactcgccggcggcaccgacccggtgcag
gcggcggcgcccggcacaatccggggcgacttcgctctagagacgcagttcaacctggtg
cacgggtctgattcggccgaatccgcgcagcgcgaaatcgcgctctggtttcccggcgcc
tag

DBGET integrated database retrieval system