KEGG   Mycobacterium bovis BCG Korea 1168P: K60_034460Help
Entry
K60_034460        CDS       T02451                                 

Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
mbk  Mycobacterium bovis BCG Korea 1168P
Pathway
mbk00240  Pyrimidine metabolism
mbk00983  Drug metabolism - other enzymes
mbk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbk00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    K60_034460
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    K60_034460
Enzymes [BR:mbk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     K60_034460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: AGE69356
Position
complement(3696213..3697496)
Genome map
AA seq 427 aa AA seqDB search
MTDFAFDAPTVIRTKRDGGRLSDAAIDWVVKAYTDGRVADEQMSALLMAIVWRGMDRGEI
ARWTAAMLASGARLDFTDLPLATVDKHSTGGVGDKITLPLVPVVAACGGAVPQASGRGLG
HTGGTLDKLESITGFTANLSNQRVREQLCDVGAAIFAAGQLAPADAKLYALRDITGTVES
LPLIASSIMSKKLAEGAGALVLDVKVGSGAFMRSPVQARELAHTMVELGAAHGVPTRALL
TEMNCPLGRTVGNALEVAEALEVLAGGGPPDVVELTLRLAGEMLELAGIHGRDPAQTLRD
GTAMDRFRWLVAAQGGDLSKPLPIGSHSETVTAGASGTMGDIDAMAVGLAAWRLGAGRSR
PGARVQHGAGVRIHRRPGEPVVVGEPLFTLYTNAPERFGAARAELAGGWSIRDSPPQVRP
LIVDRIV
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacttcgcattcgacgccccgaccgtcatccgcaccaaacgtgacggcggccgg
ttgtccgacgccgccatcgactgggtcgtcaaggcctataccgacggccgggtcgccgac
gaacagatgtcggcgctgctgatggcgatcgtttggcggggcatggaccgcggcgagatc
gccagatggacggcggccatgctggcctcgggtgcccggctggatttcaccgatctgcca
ctagcgaccgtggacaagcattccaccggcggggtaggtgacaaaatcacgctgccattg
gtgcccgtcgtcgccgcctgcggtggcgcagtgccccaggcgtcgggccgcggactcggc
cacaccggcggcaccctggacaagctggaatccatcaccgggttcaccgcgaatctgtcc
aaccagcgggtgcgcgagcagctttgcgacgtcggcgccgcgatcttcgccgccggccag
ctggcgccagccgatgccaagctgtatgcgctgcgcgacattaccggcaccgtcgaatcg
ctgccgttgatcgccagttcgattatgagcaagaagctggctgagggtgcgggtgcactg
gtgctcgacgtcaaggttggttccggggccttcatgaggtcgccagtgcaggcgcgcgaa
cttgcgcacaccatggtcgaactgggcgcggcgcatggcgtgcccacccgtgccctgctg
acggagatgaactgcccgctgggtcgaaccgtcggcaatgcgctcgaggtggccgaggcg
ctggaggtgctggccggcggcggaccgcccgacgtggtggagctgacgttgcggctggcc
ggcgagatgctcgagcttgccgggatccacggccgggacccggcccagacgctgcgggac
ggcaccgcaatggaccggtttcgctggttggttgccgcgcagggaggtgacttgtcgaaa
ccgttgccgatcggttcgcattcggaaaccgtcacggcgggcgcgagcggcacaatgggc
gacatcgatgcgatggcagtggggttagcggcatggcgactcggtgcgggcaggtcccgc
ccgggcgcacgcgtacagcacggtgcgggggtgcggattcatcgccgcccgggggagccg
gttgtggtcggtgagccgttgttcaccctctacacgaatgctcccgagcgctttggtgcg
gcgcgagccgagctggccggcggttggagtatccgggacagtccgccgcaggtgcggccg
ctaatcgtcgatcggatcgtctga

DBGET integrated database retrieval system