KEGG   Moraxella bovoculi: AAX09_01645Help
Entry
AAX09_01645       CDS       T04324                                 

Definition
(GenBank) diacylglycerol kinase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
mbl  Moraxella bovoculi
Pathway
mbl00670  One carbon pool by folate
mbl00790  Folate biosynthesis
mbl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AAX09_01645
   00670 One carbon pool by folate
    AAX09_01645
Enzymes [BR:mbl01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     AAX09_01645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: AKG18328
Position
complement(343353..343865)
Genome map
AA seq 170 aa AA seqDB search
MNNIKIIHVVAKDRQNCIGKANDLAWHIPADLKHFKEITAGGVIVMGRKTFESLGRPLPN
RTHHVITRDTAWTADGVAVAHDLPTAIKSAKADATRLGKDRIFVIGGGEIYRQSLSMADI
LEITEVDLDVQGDTHYPAIGNEFKEIWRSEQQTDDKSGIAFEFTTWQRQS
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgaataacatcaagatcatccatgtggtcgccaaagaccgccaaaactgcataggcaaa
gccaacgacctagcttggcatatccctgctgatttaaagcattttaaagagattaccgca
gggggcgtgattgtcatggggcgaaagacctttgagtcgctcggtcgacccttgcccaat
cggacacatcacgtcattacacgagatacggcatggacagcagacggtgtggcggtcgct
catgatttgccaaccgccatcaagagtgccaaagctgacgcgacgcggctgggtaaagat
agaatttttgttattggcggaggcgagatttaccgccaaagcctaagcatggcggatatc
ttagaaatcaccgaagtcgatctggacgtgcaaggtgacacgcattatcctgccatcggc
aatgaattcaaggaaatctggcgttcagagcaacaaaccgatgacaagagcggcattgct
tttgaattcaccacttggcaacgccaatcttaa

DBGET integrated database retrieval system