KEGG   Moraxella bovoculi: AAX09_06495Help
Entry
AAX09_06495       CDS       T04324                                 

Definition
(GenBank) phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
mbl  Moraxella bovoculi
Brite
KEGG Orthology (KO) [BR:mbl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    AAX09_06495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AKG19075
Position
complement(1429123..1430712)
Genome map
AA seq 529 aa AA seqDB search
MVNSAKQSTPMLANVFFAVLLAGMCVYFVMWGLEYTLHQQVLLFMVASFFGIFMAFNIGG
NDVANSFGTSVGAGTLTVTQALAVAAIFEVSGAVLAGAAVTDTIRSGIVDIGKLGVSPNQ
FIYLMLSALAAAAFWLLFATKKGLPVSTTHAIIGGIVGSSIVLGISFGGSELAFSTVKWS
KIGEIAISWVVSPVLGGLLSYILYGLIKRNILAYNDKVEVRVKSLKARKKALKREQKEHF
EALNDDEKLPYTTALLRDQEAFNEGECQRDELETEYYRSLHDIENERSNLDTLKALKTWV
PLIAALGAVIMTAMVVFKGLKNTGLNLSTLHASLVMGMIGAMVWLTAFIYTKTIRGKHKE
DLGKATFIMFSWMQVFTACAFAFSHGSNDIANAVGPFVAILDVIKENAIAAKASVPAPVM
LTFGVSLIVGLWFIGKEVIQTVGTNLTEMHPASGFAAELAAAAVVMGASSLGIPVSSTHI
LVGAVLGIGIVNKNTNWKLMKPIGLAWVITLPAAACISALFFVVLSNVM
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggtaaattcagcgaaacaaagcacacccatgctggcaaatgttttctttgcggtattg
cttgcagggatgtgcgtttattttgtgatgtgggggttggagtataccttgcatcaacaa
gtgctgctatttatggtagcaagcttttttggtattttcatggcgtttaacatcggcggt
aatgacgtggcgaactcgttcggtacgtctgtcggtgcaggcacattgaccgtcacccaa
gcacttgcggtggcggctatttttgaggtgtcgggtgcggtattggccggtgctgcggta
actgacaccatccgaagtggtatcgtggacatcggcaagctgggcgtatcgccaaatcag
ttcatctatctgatgctgtcggcgcttgcggcggctgctttttggttgcttttcgccacc
aaaaagggcttgccagtatcgaccacacacgccatcattggaggtatcgttggttcatcc
atcgtgcttggtattagcttcggtggttcagagcttgcgttctcaaccgttaaatggtca
aaaatcggcgaaatcgccatttcctgggtggtgtcacctgtgcttggcggtctgctatct
tatatcctatatggtcttatcaagcgcaatatcttggcgtataacgacaaagtagaagtg
cgtgtcaagtcattaaaagctcgaaaaaaagccctaaaacgcgaacaaaaagagcatttt
gaggcattaaatgatgatgagaagctgccttataccaccgcgctgctgcgtgaccaagaa
gctttcaacgaaggcgaatgtcagcgtgatgagcttgagacggaatattatcgctcacta
cacgacattgagaacgagcgcagtaatctagacacccttaaagccctaaaaacttgggtg
cccttaatcgcggcgcttggcgcggtcatcatgacagcgatggtggtattcaagggtcta
aagaacacgggtctaaacttatcaacgctgcacgcaagccttgtgatgggcatgattggt
gcgatggtgtggctaactgccttcatctataccaagaccattcgcggtaagcataaagaa
gacctaggcaaggcgacattcatcatgttcagctggatgcaggtatttaccgcgtgtgct
tttgctttctcgcatggttcgaacgacatcgcgaacgcggtcggtcctttcgttgccatc
ctagatgtcatcaaagaaaacgccatcgcagccaaggcatcagttcctgcgcctgtcatg
cttacctttggcgtctcgcttatcgtaggtctgtggttcatcggtaaagaagtcattcag
actgtcggcacgaatctaaccgagatgcatcctgcatcaggctttgctgcagagctagca
gcagcagcggtcgtgatgggtgcatctagcttgggtattcctgtatctagtacgcacatt
ctggtgggtgcggtattgggtattgggattgttaataagaacactaactggaagctcatg
aagccgatcggacttgcttgggtcatcacattgccagcggcggcatgtatcagtgcgctg
ttctttgtggtgctttctaatgtgatgtaa

DBGET integrated database retrieval system