KEGG   Moraxella bovoculi: AAX09_08265Help
Entry
AAX09_08265       CDS       T04324                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
mbl  Moraxella bovoculi
Pathway
mbl00970  Aminoacyl-tRNA biosynthesis
mbl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbl00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AAX09_08265
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mbl03029]
    AAX09_08265
Enzymes [BR:mbl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     AAX09_08265
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     AAX09_08265
Mitochondrial biogenesis [BR:mbl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AAX09_08265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AKG19364
Position
1769798..1771276
Genome map
AA seq 492 aa AA seqDB search
MTQLHELSVDAIVKGLANKDFSSVDITTHLLSRIEKLDGQINSFVTATQEQALNAAKAAD
KLRADGDTRPLLGVPMAHKDNLCTKGVLTSAGSKILSNFVSPYDATVVENIANAGFISLG
KLNMDEFAMGSDNESSYFGAVHNPWDAARVPGGSSGGSAAAVASGFIPVATGSDTGGSIR
QPASFCGITGIKPTYGRVSRYGMIAYASSLDQAGTFGKSALDCAYLLSPMTGHDPKDATS
INRPTEDYVADILVAKTDGKPLAGKKIGVAKAYFGAGLDSEVEKSIRTALAKYEELGAQI
VEVDITDPAVTLATYYLLAPAEASSNLSRYDGVRFGYRCEDPKDLIDLYTRSRSEGFGTE
VQRRIIMGTYALSAGYFDAYYTKAQKVRRLIVDDFKKAFEKCDIIASPTAPTTAYKLGEN
LDPASIYLGDVYTIGVNLAGLPALSHPVGQANGLPVGLQLIGKHWAESELLKTAHVYQAN
TKFHQEMADLVK
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgacacaactacacgaattaagcgttgacgccatcgtcaaaggcttggcaaataaagat
tttagcagtgttgatattaccacacacctattatcacgcatcgagaagctagatggacaa
attaacagctttgttaccgccactcaagaacaagcgttaaacgccgccaaagctgccgac
aaactgcgcgcagatggcgacactcgccccctgcttggcgtgccaatggctcacaaagac
aacctatgcaccaaaggcgtgctgacatcggcaggctcaaaaatcctatccaatttcgtc
tcgccttatgacgcaactgtagtggaaaacatcgccaacgctggatttatcagcctaggc
aagctcaacatggacgaatttgccatgggttcggacaacgaaagctcgtattttggggcg
gtacacaacccttgggacgccgctcgcgtaccaggtggttcatcaggcggatctgcggca
gcggtcgccagtgggttcatccctgtggcgacaggctcggatacaggtggctctattcgc
caacctgccagcttttgtggcatcacgggcattaagcctacctatgggcgtgtgtctcgc
tatggcatgattgcttatgcgtcaagccttgatcaagcaggcacatttggcaaatccgcc
ctagactgtgcctacctgctttccccgatgacaggacacgaccccaaagacgcaacatcc
atcaaccgccccaccgaagattatgtggcggacattttggtggcaaaaacagacggcaaa
cccctagcaggcaaaaaaatcggcgtggcaaaggcgtattttggggcaggtcttgatagt
gaagtagaaaaatccattcgcaccgccctagccaaatatgaagagctgggggcccaaatc
gtggaagtggacatcaccgaccctgccgtaacgcttgccacttattatctgctcgcccct
gccgaagccagctcaaacctgtctcgctatgacggtgtgcgctttggttatcgctgcgaa
gatccaaaagatctgatcgatctatatacgcgcagccgctctgaaggctttggtactgaa
gttcagcgccgtatcatcatgggaacgtatgccctatcggcagggtactttgacgcttat
tataccaaagcccagaaggttcgccgtcttatcgtggacgactttaaaaaggcgtttgaa
aaatgcgacatcatcgcaagccctactgcaccgaccaccgcctataagctgggtgagaac
ttagaccctgccagcatctatcttggtgacgtatataccattggcgtgaacttggcaggt
ctgcccgccctatcgcaccctgtgggacaagcgaacggcttgcctgtgggcttgcaacta
attggcaaacattgggcggaaagcgaacttctaaaaaccgctcatgtgtatcaggcgaat
accaagtttcatcaagagatggcggatttggtgaagtga

DBGET integrated database retrieval system