KEGG   Moraxella bovoculi: AAX09_09235Help
Entry
AAX09_09235       CDS       T04324                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mbl  Moraxella bovoculi
Pathway
mbl00071  Fatty acid degradation
mbl00072  Synthesis and degradation of ketone bodies
mbl00280  Valine, leucine and isoleucine degradation
mbl00310  Lysine degradation
mbl00362  Benzoate degradation
mbl00380  Tryptophan metabolism
mbl00620  Pyruvate metabolism
mbl00630  Glyoxylate and dicarboxylate metabolism
mbl00640  Propanoate metabolism
mbl00650  Butanoate metabolism
mbl00900  Terpenoid backbone biosynthesis
mbl01100  Metabolic pathways
mbl01110  Biosynthesis of secondary metabolites
mbl01120  Microbial metabolism in diverse environments
mbl01130  Biosynthesis of antibiotics
mbl01200  Carbon metabolism
mbl01212  Fatty acid metabolism
mbl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mbl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AAX09_09235
   00630 Glyoxylate and dicarboxylate metabolism
    AAX09_09235
   00640 Propanoate metabolism
    AAX09_09235
   00650 Butanoate metabolism
    AAX09_09235
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AAX09_09235
   00072 Synthesis and degradation of ketone bodies
    AAX09_09235
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AAX09_09235
   00310 Lysine degradation
    AAX09_09235
   00380 Tryptophan metabolism
    AAX09_09235
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AAX09_09235
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AAX09_09235
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AAX09_09235
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mbl04147]
    AAX09_09235
Enzymes [BR:mbl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AAX09_09235
Exosome [BR:mbl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AAX09_09235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AKG19514
UniProt: A0A0U2BPC1
Position
complement(1987738..1988916)
Genome map
AA seq 392 aa AA seqDB search
MTDIVIVSAKRTAIGSFLGSLASVSAPKLGASVIEGLMDDVGLDKSLVSEVIMGNVLTTG
VGQNPARQAAISAGFPVETPATTVNVVCGSGLKAVHMGAQAIKAGDATIVIAGGQESMSQ
SPHFVHLRDGIKMGNGTLTDSMVADGLTDVYNGYHMGITAENVAEKLDIDRAAQDEFALH
SQTKAAKAQADGKFVSQIVPVSVPQRKGEPVVVDKDEYIKPNTTLEGLAKLKPAFKKDGT
VTAGNASGLNDGAAAVLLMGADTAKKHNLTPLVKIVAYVVTGIDPAVMGLGPVGAVKSVL
DKAGWSLADVDLIEANEAFSAQALGVAKELGLDGEKVNVNGGAIALGHPIGASGCRVLVT
LIHELIAQNKQKGIATLCVGGGMGLAIAVERV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgactgatattgtgatcgtgtctgccaaacgcactgccattggctcgtttttggggtca
ttggcaagcgtgtctgcgcccaagcttggggcgagcgtcattgaggggctgatggatgat
gtgggactggataagtcgctcgtcagcgaggtgatcatgggcaatgtactcaccacaggc
gtgggacaaaatcctgctcgtcaggcggcgatatcggcaggttttcctgtcgaaacgcca
gcgaccaccgtcaatgtcgtctgcggctctggtctaaaagcggtgcacatgggtgcacaa
gccatcaaagcgggcgatgccaccatcgtcatcgcaggtggtcaagaatcgatgtcgcaa
agcccacactttgtgcatctgcgtgatggcatcaagatgggtaatggcacattaaccgac
tcgatggtggcggacggcttgaccgatgtgtacaatggctatcacatgggcatcaccgcc
gaaaatgtcgccgaaaaattagacatcgatcgcgctgcccaagatgaatttgctctacat
tcacagaccaaagcagccaaggctcaagccgatggcaaattcgtcagccaaatcgtccct
gtgtctgtgccacagcgaaagggcgagcctgtggtcgtggataaggatgaatacatcaag
ccaaacactaccctagaagggcttgccaagctcaaacctgccttcaaaaaagacggtacg
gtaactgctggcaatgcctcagggctaaacgacggagcggcggcagtactgctcatggga
gcggacactgccaagaagcacaatctgacgccattggtaaaaatcgtggcttatgtggtg
acgggcatcgaccctgccgtgatgggtctgggtcctgtgggtgcggtcaagagcgtactg
gataaggcgggctggtctttggcggatgtcgatttgatcgaggccaacgaagccttttct
gctcaagctttgggcgtcgccaaggagcttgggcttgatggcgagaaagtcaatgtcaat
ggcggtgcaatcgccctaggacaccccatcggcgcatcaggctgccgcgttttggtcaca
ctcatccatgagcttatcgcccaaaacaagcaaaaaggcatcgccaccttgtgcgtcggt
ggtggcatggggcttgccattgcggttgagcgggtgtag

DBGET integrated database retrieval system