KEGG   Moraxella bovoculi: AAX09_09290Help
Entry
AAX09_09290       CDS       T04324                                 

Definition
(GenBank) maleylacetoacetate isomerase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
mbl  Moraxella bovoculi
Pathway
mbl00350  Tyrosine metabolism
mbl00643  Styrene degradation
mbl01100  Metabolic pathways
mbl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mbl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    AAX09_09290
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    AAX09_09290
Enzymes [BR:mbl01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     AAX09_09290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C GST_C_2 GST_N_4 Tom37 GST_C_6
Motif
Other DBs
NCBI-ProteinID: AKG19523
UniProt: A0A3F3A8H1
Position
complement(2000373..2001008)
Genome map
AA seq 211 aa AA seqDB search
MKLYSYFRSSASYRVRIALNLKNLPYDIIPIHLVKGEQKSDGYKDKNPSGLIPALELDDG
TIITQSMAILDYLENEYPSVPLLPKDNANRAIVLSMCNIIACDTHPLNNLRVLQYLANDL
KISDEQKQNWYAHWILVNFTALENLLKIHGGKYCFGDELSLADACLIPQVYNAKRFKVDL
AGFPNILKVVENCHQLDAFVKASPEKQVDFE
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttattcttattttagaagttcggcaagttaccgagtgcgcattgctttaaat
ctgaaaaacttgccttatgacattatccccattcatttggtcaaaggcgaacaaaagtca
gatggctataaagataaaaaccccagcggtttaatacctgccttggagcttgatgatggc
accatcatcacgcaatccatggcgattttggactatttggaaaatgaatatccaagtgtg
ccattattgccaaaagacaatgcgaatagggcaattgtcttgtcgatgtgcaatatcatt
gcttgtgatacgcatcctttaaacaatttaagggtgttgcaatatcttgcaaatgatttg
aaaatcagcgatgagcaaaaacaaaattggtatgctcattggattttggttaattttact
gctttggaaaatttattaaaaattcatggtggaaaatactgttttggcgatgagctgagt
ttggcagatgcttgtctcataccgcaggtgtataatgccaagcgttttaaggtggatttg
gcaggttttcccaatattttaaaagtggtggaaaattgccatcaactggatgcatttgtc
aaagcaagccctgaaaagcaggtggattttgagtga

DBGET integrated database retrieval system