KEGG   Moraxella bovoculi: AAX09_09315Help
Entry
AAX09_09315       CDS       T04324                                 

Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
mbl  Moraxella bovoculi
Pathway
mbl00360  Phenylalanine metabolism
mbl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mbl00790  Folate biosynthesis
mbl01100  Metabolic pathways
mbl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mbl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    AAX09_09315
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AAX09_09315
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AAX09_09315
Enzymes [BR:mbl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     AAX09_09315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AKG19851
UniProt: A0A0U2BQI9
Position
2005521..2006318
Genome map
AA seq 265 aa AA seqDB search
MQSKTLYTAHMPDSHGHIAWSADENAIWRDLRIRQQKSIIGKACDEYTQGLNTLDLPIDH
IPKLGNLDTTLQQTTGWQTAAVPALISFGKFFELLAHQRFPVATFIRTRDDFDYIQEPDI
FHEIIGHLPLLTHPAFANFTHTYGKLGLQADKKTRVFLARLYWFTMEFGLINTKDGLRIY
GGGILSSPAETEYAVSGKPEYRPFNVNDILRTPYRIDKIQPIYYVIDKPEQLFSLTEKSL
MAEVNKAMEQGLFEPHPSLLDDQTA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcaaaaaccctctacactgcccacatgcccgattcgcacggtcacatcgcatgg
tcagcggatgaaaatgccatctggcgtgacttgcgcatccgccaacaaaaaagcatcatc
ggcaaggcttgcgatgaatacacccaaggcttaaatacgctcgatttgccaatcgatcac
attcctaagcttggcaatctagacaccactttgcagcagacgacaggctggcagactgcc
gccgtgcctgcactcatctcgtttggcaagttttttgagctgcttgcgcatcagcgattt
cctgtggcgactttcattcgcactcgtgatgattttgactacatccaagagcctgacatc
tttcacgaaatcatcggtcatttgccactattaacacatcccgcctttgccaattttacg
cacacctatggcaagctgggactacaagccgataaaaagacacgagtatttctggcaaga
ctttattggtttacgatggaatttggtctgattaacaccaaagacggtcttagaatctat
ggcggtggtattttgtcatctcctgctgagacagagtatgccgtcagtggtaaaccagag
taccgaccctttaatgtcaatgacattttaagaacaccctatcgcattgataaaatccaa
cccatctattatgtcattgacaaaccagagcagctgttttcactgaccgaaaaatcattg
atggctgaagtgaacaaagccatggagcaaggattatttgagccacatccaagcctgctt
gatgatcagacggcatga

DBGET integrated database retrieval system