KEGG   Mycobacterium bovis BCG Mexico: BCGMEX_0976Help
Entry
BCGMEX_0976       CDS       T01727                                 

Gene name
sucC
Definition
(GenBank) Succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mbm  Mycobacterium bovis BCG Mexico
Pathway
mbm00020  Citrate cycle (TCA cycle)
mbm00640  Propanoate metabolism
mbm00660  C5-Branched dibasic acid metabolism
mbm01100  Metabolic pathways
mbm01110  Biosynthesis of secondary metabolites
mbm01120  Microbial metabolism in diverse environments
mbm01130  Biosynthesis of antibiotics
mbm01200  Carbon metabolism
Module
mbm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mbm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mbm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BCGMEX_0976 (sucC)
   00640 Propanoate metabolism
    BCGMEX_0976 (sucC)
   00660 C5-Branched dibasic acid metabolism
    BCGMEX_0976 (sucC)
Enzymes [BR:mbm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BCGMEX_0976 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A Baculo_E25
Motif
Other DBs
NCBI-ProteinID: AET18260
Position
1062720..1063883
Genome map
AA seq 387 aa AA seqDB search
MDLFEYQAKELFAKHNVPSTPGRVTDTAEGAKAIATEIGRPVMVKAQVKIGGRGKAGGVK
YAATPQDAYEHAKNILGLDIKGHIVKKLLVAEASDIAEEYYLSFLLDRANRTYLAMCSVE
GGMEIEEVAATKPERLAKVPVNAVKGVDLDFARSIAEQGHLPAEVLDTAAVTIAKLWELF
VAEDATLVEVNPLVRTPDHKILALDAKITLDGNADFRQPGHAEFEDRAATDPLELKAKEH
DLNYVKLDGQVGIIGNGAGLAMSTLDVVAYAGEKHGGVKPANFLDIGGGASAEVMAAGLD
VVLGDQQVKSVFVNVFGGITSCDAVATGIVKALGMLGDEANKPLVVRLDGNNVEEGRRIL
TEANHPLVTLVATMDEAADKAAELASA
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggatcttttcgagtatcaagccaaggagttattcgccaagcacaacgtgcccagcacg
ccgggtcgggtgaccgacacagccgagggtgccaaggctatcgccacggagatcgggcgt
ccggtgatggtcaaagcgcaggtcaagatcggcggccggggcaaggccggtggcgtcaaa
tacgccgcgaccccacaagacgcgtacgagcacgccaagaacatcctcggcctggacatc
aaaggacacatcgtcaagaaactgctggtcgctgaggctagcgatatcgccgaggagtac
tacctatccttcctgctcgaccgggccaaccgcacctacctggcgatgtgctcggtggag
ggcggcatggagatcgaagaggtagcggccaccaaacccgagcggctcgccaaagtcccg
gtgaatgccgtcaagggcgttgacctagatttcgcgcggtccatcgccgaacagggtcat
cttccggccgaggtgctcgacaccgcagcggtcaccatcgccaagctgtgggagctcttc
gtcgccgaggacgcgacgctggttgaggtcaacccgttggtgcggacgcctgaccacaag
atcctcgcgctggatgccaagatcaccctcgacggcaacgccgatttccgtcagcctggc
catgccgagttcgaggatcgagctgccaccgatccactggagttgaaggccaaggagcac
gacctcaactacgtcaagctggacggtcaggtggggatcatcggcaatggcgcgggcttg
gcgatgtcgactctcgacgtcgtcgcgtatgccggtgagaagcacggcggagtcaagccg
gccaacttcctggatatcggcggcggcgcttcggccgaggtgatggccgcgggtctggac
gtggtgctgggcgaccagcaggtcaagagcgtgttcgtcaacgtcttcggtggcatcacc
tcgtgcgatgcggtggcgaccgggatcgtcaaggcgctgggcatgctgggtgacgaagcc
aacaagccgctggtggttcggctcgacggcaacaacgtcgaggaaggccgtcgcatcctg
accgaggccaaccaccccctggtgacactggtggcgacgatggacgaagccgccgacaag
gccgctgagctggcgagcgcctga

DBGET integrated database retrieval system