KEGG   Mycobacterium tuberculosis variant bovis BCG Mexico: BCGMEX_1154Help
Entry
BCGMEX_1154       CDS       T01727                                 

Gene name
zwf1
Definition
(GenBank) Glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
mbm  Mycobacterium tuberculosis variant bovis BCG Mexico
Pathway
mbm00030  Pentose phosphate pathway
mbm00480  Glutathione metabolism
mbm01100  Metabolic pathways
mbm01110  Biosynthesis of secondary metabolites
mbm01120  Microbial metabolism in diverse environments
mbm01130  Biosynthesis of antibiotics
mbm01200  Carbon metabolism
Module
mbm_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
mbm_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:mbm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BCGMEX_1154 (zwf1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BCGMEX_1154 (zwf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mbm04147]
    BCGMEX_1154 (zwf1)
Enzymes [BR:mbm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     BCGMEX_1154 (zwf1)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     BCGMEX_1154 (zwf1)
Exosome [BR:mbm04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BCGMEX_1154 (zwf1)
  Exosomal proteins of colorectal cancer cells
   BCGMEX_1154 (zwf1)
  Exosomal proteins of bladder cancer cells
   BCGMEX_1154 (zwf1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AET18437
Position
1245401..1246801
Genome map
AA seq 466 aa AA seqDB search
MVDGGGGASDLLVIFGITGDLARKMTFRALYRLERHQLLDCPILGVASDDMSVGQLVKWA
RESIGRTEKIDDAVFDRLAGRLSYLHGDVTDSQLYDSLAELIGSACRPLYYLEMPPALFA
PIVENLANVRLLERARVAVEKPFGHDLASALELNARLRAVLGEDQILRVDHFLGKQPVVE
LEYLRFANQALAELWDRNSISEIHITMAEDFGVEDRGKFYDAVGALRDVVQNHLLQVLAL
VTMEPPVGSSADDLNDKKAEVFRAMAPLDPDRCVRGQYLGYTEVAGVASDSATETYVALR
TEIDNWRWAGVPIFVRAGKELPAKVTEVRLFLRRVPALAFLPNRRPAEPNQIVLRIDPDP
GMRLQISAHTDDSWRDIHLDSSFAVDLGEPIRPYERLLYAGLVGDHQLFAREDSIEQTWR
IVQPLLDNPGEIHRYDRGSWGPEAAQSLLRGHRGWQSPWLPRGTDA
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
ttggttgacggcggaggtggcgcgtcagatctgttggtgatcttcggaattaccggtgac
ctggcccgcaagatgaccttccgcgcgttgtatcggctcgagcgccaccagttgctggac
tgccccatcctgggtgtggccagtgacgacatgtccgtcgggcagttggtcaagtgggct
cgcgagtccatcggtcgtaccgaaaagatcgacgatgcggtgttcgaccggttggcgggc
cggttgtcctacctgcacggtgacgtcaccgacagccagctctacgattcgctggccgaa
ctgattggctcggcctgtcggccgctgtattacctggaaatgccgccggcgctgttcgcg
ccgattgtcgaaaatctcgcgaacgtgcggctgttggagcgcgcacgcgttgccgtggaa
aagccgttcggccacgacctggcctccgcgctcgaactcaacgcccggctgcgagcggtg
ttgggcgaagaccaaatcctgcgtgtggaccactttctgggcaagcagcccgtcgtcgag
ctggagtacctgaggttcgccaatcaggcgttagccgagctctgggatcgcaacagcatc
tccgagatccacatcaccatggccgaggacttcggggtggaggaccgcggcaagttttac
gacgccgtcggtgccctgcgtgacgtggtgcaaaaccatctgctgcaggtgctggcgctg
gtgacgatggaaccgccggtcggttccagcgccgatgacctcaacgacaagaaggccgag
gtcttccgggcgatggcgccgctggatcccgatcggtgcgtgcgtgggcagtacctcggc
tacaccgaagttgcgggcgtagcaagcgattcggcgaccgaaacgtatgtcgcgctgcga
accgagatcgacaactggcgctgggccggggtgccgatcttcgtgcgggccggaaaagag
ctgcccgcgaaggtcaccgaagtacggctatttctacgccgagttccggcattggccttt
ctgcccaaccgccgaccggccgagcccaaccagattgtgctgcgtatcgaccccgatccg
ggtatgcgactgcagatttcggcccacaccgacgactcgtggcgagatatccacctggac
tcctcgttcgcggtggacctcggtgaaccgatacgaccctatgagcggctgctgtatgcc
ggattggtcggcgatcaccagttgttcgcccgcgaggacagcatcgagcagacgtggcgg
atcgtgcagccgctgctcgacaacccgggtgaaatccatcggtacgatcgcggttcctgg
ggtccggaagccgcgcagtcgttgctgcgcggtcaccgcggttggcagtcgccgtggctg
ccccgcggcacggacgcatga

DBGET integrated database retrieval system