KEGG   Mycobacterium bovis BCG Mexico: BCGMEX_1169Help
Entry
BCGMEX_1169       CDS       T01727                                 

Definition
(GenBank) Putative acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mbm  Mycobacterium bovis BCG Mexico
Pathway
mbm00071  Fatty acid degradation
mbm00072  Synthesis and degradation of ketone bodies
mbm00280  Valine, leucine and isoleucine degradation
mbm00310  Lysine degradation
mbm00362  Benzoate degradation
mbm00380  Tryptophan metabolism
mbm00620  Pyruvate metabolism
mbm00630  Glyoxylate and dicarboxylate metabolism
mbm00640  Propanoate metabolism
mbm00650  Butanoate metabolism
mbm00900  Terpenoid backbone biosynthesis
mbm01100  Metabolic pathways
mbm01110  Biosynthesis of secondary metabolites
mbm01120  Microbial metabolism in diverse environments
mbm01130  Biosynthesis of antibiotics
mbm01200  Carbon metabolism
mbm01212  Fatty acid metabolism
mbm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mbm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCGMEX_1169
   00630 Glyoxylate and dicarboxylate metabolism
    BCGMEX_1169
   00640 Propanoate metabolism
    BCGMEX_1169
   00650 Butanoate metabolism
    BCGMEX_1169
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BCGMEX_1169
   00072 Synthesis and degradation of ketone bodies
    BCGMEX_1169
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCGMEX_1169
   00310 Lysine degradation
    BCGMEX_1169
   00380 Tryptophan metabolism
    BCGMEX_1169
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BCGMEX_1169
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCGMEX_1169
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BCGMEX_1169
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mbm04147]
    BCGMEX_1169
Enzymes [BR:mbm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BCGMEX_1169
Exosome [BR:mbm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCGMEX_1169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C
Motif
Other DBs
NCBI-ProteinID: AET18452
Position
1266008..1266250
Genome map
AA seq 80 aa AA seqDB search
MQLGNQNTMRFAGRPQRFRQSAYPLFNPNSAIALGHPFGGSGARLMTTVLHHMPDKGIRY
GLQTMCEGRGQANATIVELL
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
atgcagcttggcaatcaaaacactatgagattcgcagggcggcctcagcgttttcgccaa
agcgcttaccccctgttcaaccccaacagcgcgatcgcgcttggccacccattcggcggc
tcgggggcacggttgatgactacagtgctacaccacatgccggacaagggaattcgctac
ggcttacagacgatgtgcgagggccgcggccaagccaatgccaccattgtggagttgctg
tga

DBGET integrated database retrieval system