KEGG   Mycobacterium bovis BCG Mexico: BCGMEX_2032cHelp
Entry
BCGMEX_2032c      CDS       T01727                                 

Gene name
pfkB
Definition
(GenBank) Putative phosphofructokinase
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
mbm  Mycobacterium bovis BCG Mexico
Pathway
mbm00010  Glycolysis / Gluconeogenesis
mbm00030  Pentose phosphate pathway
mbm00051  Fructose and mannose metabolism
mbm00052  Galactose metabolism
mbm00680  Methane metabolism
mbm01100  Metabolic pathways
mbm01110  Biosynthesis of secondary metabolites
mbm01120  Microbial metabolism in diverse environments
mbm01130  Biosynthesis of antibiotics
mbm01200  Carbon metabolism
mbm01230  Biosynthesis of amino acids
Module
mbm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mbm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCGMEX_2032c (pfkB)
   00030 Pentose phosphate pathway
    BCGMEX_2032c (pfkB)
   00051 Fructose and mannose metabolism
    BCGMEX_2032c (pfkB)
   00052 Galactose metabolism
    BCGMEX_2032c (pfkB)
  Energy metabolism
   00680 Methane metabolism
    BCGMEX_2032c (pfkB)
Enzymes [BR:mbm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BCGMEX_2032c (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: AET19310
Position
complement(2238422..2239441)
Genome map
AA seq 339 aa AA seqDB search
MTEPAAWDEGKPRIITLTMNPALDITTSVDVVRPTEKMRCGAPRYDPGGGGINVARIVHV
LGGCSTALFPAGGSTGSLLMALLGDAGVPFRVIPIAASTRESFTVNESRTAKQYRFVLPG
PSLTVAEQEQCLDELRGAAASAAFVVASGSLPPGVAADYYQRVADICRRSSTPLILDTSG
GGLQHISSGVFLLKASVRELRECVGSELLTEPEQLAAAHELIDRGRAEVVVVSLGSQGAL
LATRHASHRFSSIPMTAVSGVGAGDAMVAAITVGLSRGWSLIKSVRLGNAAGAAMLLTPG
TAACNRDDVERFFELAAEPTEVGQDQYVWHPIVNPEASP
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgacggagccagcggcgtgggacgaaggcaagccgcgaatcatcactttgaccatgaac
cccgccttggacatcacgacgagcgtcgacgtggtgcgcccgaccgagaaaatgcgttgt
ggcgcacctcgctacgatcccggcggcggcggtatcaatgtcgcccgcattgtgcatgtc
ctcggcggttgctcgacagcactgttcccggccggcgggtcgaccgggagcctgctgatg
gcgctgctcggtgatgcgggagtgccatttcgcgtcattccgatcgcggcctcgacgcgg
gagagcttcacggtcaacgagtccaggaccgccaagcagtatcgtttcgtgcttccgggg
ccgtcgctgaccgtcgcggagcaggagcaatgcctcgacgaactgcgcggtgcggcggct
tcggccgcctttgtggtggccagtggcagcctgccgccaggtgtggctgccgactactat
cagcgggttgccgacatctgccgccgatcgagcactccgctgatcctggatacatctggt
ggcgggttgcagcacatttcgtccggggtgtttcttctcaaggcgagcgtgcgggaactg
cgcgagtgcgtcggatccgaactgctgaccgagcccgaacaactggccgccgcacacgaa
ctcattgaccgtgggcgcgccgaggtcgtggtggtctcgcttggatctcagggcgcgcta
ttggccacacgacatgcgagccatcgattttcgtcgattccgatgaccgcggttagcggt
gtcggcgccggcgacgcgatggtggccgcgattaccgtgggcctcagccgtggctggtcg
ctcatcaagtccgttcgcttgggaaacgcggcaggtgcagccatgctgctgacgccaggc
accgcggcctgcaatcgcgacgatgtggagaggttcttcgagctggcggccgaacccacc
gaagtcgggcaggatcaatacgtttggcacccgatcgttaacccggaagcctcgccatga

DBGET integrated database retrieval system