KEGG   Mycobacterium tuberculosis variant bovis BCG Mexico: BCGMEX_2214cHelp
Entry
BCGMEX_2214c      CDS       T01727                                 

Gene name
gcvT
Definition
(GenBank) Aminomethyltransferase (glycine cleavage system T protein)
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
mbm  Mycobacterium tuberculosis variant bovis BCG Mexico
Pathway
mbm00260  Glycine, serine and threonine metabolism
mbm00630  Glyoxylate and dicarboxylate metabolism
mbm00670  One carbon pool by folate
mbm01100  Metabolic pathways
mbm01110  Biosynthesis of secondary metabolites
mbm01130  Biosynthesis of antibiotics
mbm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mbm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BCGMEX_2214c (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCGMEX_2214c (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BCGMEX_2214c (gcvT)
Enzymes [BR:mbm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     BCGMEX_2214c (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C
Motif
Other DBs
NCBI-ProteinID: AET19491
Position
complement(2434051..2435190)
Genome map
AA seq 379 aa AA seqDB search
MCQQGRPLGWDAVSDVPELIHGPLEDRHRELGASFAEFGGWLMPVSYAGTVSEHNATRTA
VGLFDVSHLGKALVRGPGAAQFVNSALTNDLGRIGPGKAQYTLCCTESGGVIDDLIAYYV
SDDEIFLVPNAANTAAVVGALQAAAPGGLSITNLHRSYAVLAVQGPCSTDVLTALGLPTE
MDYMGYADASYSGVPVRVCRTGYTGEHGYELLPPWESAGVVFDALLAAVSAAGGEPAGLG
ARDTLRTEMGYPLHGHELSLDISPLQARCGWAVGWRKDAFFGRAALLAEKAAGPRRLLRG
LRMVGRGVLRPGLAVLVGDETVGVTTSGTFSPTLQVGIGLALIDSDAGIEDGQQINVDVR
GRAVECQVVCPPFVAVKTR
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
gtgtgccagcagggacgcccattagggtgggacgccgtgagcgatgtgccagagctgata
cacggaccgctggaagaccgccatcgcgagctgggtgcgagtttcgccgagttcggcggc
tggctgatgccggtctcgtatgccggaaccgtcagcgagcacaacgccacccgcaccgcc
gtcggccttttcgacgtcagccacctgggcaaggcactggtccgtggaccgggtgcggcg
cagttcgtcaactccgcgctcaccaacgacctgggtcgtatcgggcccggcaaggcgcaa
tacaccttgtgctgcaccgaatccggcggtgtgatcgacgacctgatcgcctactacgtc
agcgacgacgagatctttctggtgcccaacgccgccaataccgccgcggtggtcggcgcg
ctacaagctgccgcaccgggcggtctgagcatcaccaatctgcatcggtcctacgcggtg
ctggccgtacaggggccgtgttcgaccgacgtgctcaccgcgttggggctgccaaccgag
atggactacatgggctacgccgacgcttcgtactcgggggtgccggtgcgtgtctgtcgc
accggctacaccggtgagcacggttacgaactgctgccgccatgggagtcggcgggtgtg
gtgttcgacgcactgttggcggcggtatcagccgcgggcggcgagcccgccggcctcggt
gctcgcgacacactgcgcactgaaatgggctatccgctgcacgggcacgagctttcgctg
gacatctcgccgctgcaggcccgatgcggctgggcggtcggctggcggaaggacgccttc
tttggtcgtgcggcgttgttggccgagaaagcggccgggccgcggcggctgctgcggggg
ctgcgcatggtcggtcgcggtgtgctgcgccccgggctggctgtgcttgtcggggatgag
acggttggggtcaccacgtcgggaacgttttctcccacgttgcaggtcggcatcgggctg
gcgctgatcgacagtgatgccggcatcgaagacggccagcaaatcaatgtcgacgtccgc
ggccgtgctgtcgaatgtcaagtggtgtgtccgccgttcgttgccgtgaaaacgcgctga

DBGET integrated database retrieval system