KEGG   Methanoregula boonei: Mboo_0222Help
Entry
Mboo_0222         CDS       T00578                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mbn  Methanoregula boonei
Pathway
mbn00260  Glycine, serine and threonine metabolism
mbn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mbn01100  Metabolic pathways
mbn01110  Biosynthesis of secondary metabolites
mbn01130  Biosynthesis of antibiotics
mbn01230  Biosynthesis of amino acids
Module
mbn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mbn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mboo_0222
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mboo_0222
Enzymes [BR:mbn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mboo_0222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth ThiG PcrB FMN_dh NMO IGPS NanE
Motif
Other DBs
NCBI-ProteinID: ABS54744
UniProt: A7I4T3
Position
complement(210032..210829)
Genome map
AA seq 265 aa AA seqDB search
MMGRIESVFAKKGKSAFIGFTVAGDPDKETSIRIAKALIDGGTDILEFGVPFSDPVADGP
TIQRADDRALASCTTPDTIFAIVREVRAYSEVPIVFLTYYNTIYRRGIDRFYLEAHEAGV
DGILVADMPVEESDEVAATAEKYGIDPIFLVTQTTSNERMDTIVRHARGYLYLVSVLGVT
GARKTVAPEALALLNRVRSHTDLPLAIGFGISTPEHVTTCNLAGADGVIVGSAIVDIVEK
NLGNPDAMEQDLRRYVSVMKKAAEQ
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgatgggacgtattgaatccgtctttgccaaaaaagggaagtccgcgttcatcggcttt
accgttgccggcgacccggacaaagagacatcaatcagaatcgcaaaggcgctgatcgat
ggcggcacagatatcctcgaattcggcgtgccgttttcggatccggtggcagacgggccg
acaatccagcgggcagacgaccgggcgcttgcatcctgcaccacacccgatacgatcttt
gcaatcgtccgggaagtccgggcgtactccgaagtcccgatcgtctttctgacatactac
aacacgatctatcgcaggggcatcgaccggttctacctcgaagcgcacgaggcaggcgta
gacgggatccttgttgctgacatgccggtggaggaatcggatgaggtcgctgcaaccgcg
gagaagtacgggatcgaccctatcttccttgtcacccagaccacctccaatgaacgcatg
gacaccatcgtacgccatgcccgcgggtatctgtacctcgtctcggtgctcggtgtcaca
ggtgcacgtaagaccgtagctccggaagctctcgctctcttgaaccgggtccgctcgcac
accgatcttccactcgccatcggatttgggatctccacgcccgaacatgtaaccacctgc
aacctggccggggccgatggcgtgattgtcgggagcgcgattgtggatatcgtggaaaaa
aacctaggcaatccggacgcgatggaacaagatcttcgtcgctacgtctccgtgatgaaa
aaagcagcagagcagtga

DBGET integrated database retrieval system